Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transforming Growth Factor-Beta 2 Recombinant Protein | TGF b 2 recombinant protein

Recombinant Human Transforming Growth Factor-Beta 2

Gene Names
TGFB2; LDS4; TGF-beta2
Purity
Greater than 97.0% as determined by SDS-PAGE.
Synonyms
Transforming Growth Factor-Beta 2; Recombinant Human Transforming Growth Factor-Beta 2; TGFB2 Human; Transforming Growth Factor Beta 2 Human Recombinant; Transforming growth factor; beta 2; cetermin; Glioblastoma-derived T-cell suppressor factor; polyergin; G-TSF; TGF-beta2; TGF-beta-2; transforming growth factor beta-2; BSC-1 cell growth inhibitor; TGFB-2; TGF b 2 recombinant protein
Ordering
For Research Use Only!
Host
Nicotiana benthamiana
Purity/Purification
Greater than 97.0% as determined by SDS-PAGE.
Form/Format
Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS
Sequence Length
442
Solubility
It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M-cm H2O not less than 1 ug/40 ul, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution TGFB2 Human should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Related Product Information for TGF b 2 recombinant protein
Description: TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.

Introduction: TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-beta (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing.
Product Categories/Family for TGF b 2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,573 Da
NCBI Official Full Name
transforming growth factor beta-2 isoform 1
NCBI Official Synonym Full Names
transforming growth factor, beta 2
NCBI Official Symbol
TGFB2
NCBI Official Synonym Symbols
LDS4; TGF-beta2
NCBI Protein Information
transforming growth factor beta-2; BSC-1 cell growth inhibitor; G-TSF; cetermin; glioblastoma-derived T-cell suppressor factor; polyergin; prepro-transforming growth factor beta-2
UniProt Protein Name
Transforming growth factor beta-2
UniProt Gene Name
TGFB2
UniProt Synonym Gene Names
TGF-beta-2; G-TSF; LAP
UniProt Entry Name
TGFB2_HUMAN

NCBI Description

This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers. The encoded protein is secreted and has suppressive effects of interleukin-2 dependent T-cell growth. Translocation t(1;7)(q41;p21) between this gene and HDAC9 is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. The knockout mice lacking this gene show perinatal mortality and a wide range of developmental, including cardiac, defects. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Sep 2010]

Uniprot Description

TGFB2: TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth. Homodimer; disulfide-linked. Heterodimers with TGFB1 and with TGFB3 have been found in bone. Interacts with the serine proteases, HTRA1 and HTRA3. Interacts with ASPN. Belongs to the TGF-beta family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted; Cell development/differentiation

Chromosomal Location of Human Ortholog: 1q41

Cellular Component: extracellular matrix; extracellular space; cell soma; axon; extracellular region; endosome

Molecular Function: protein binding; protein homodimerization activity; growth factor activity; protein heterodimerization activity; beta-amyloid binding; punt binding; cytokine activity; transforming growth factor beta receptor binding; receptor signaling protein serine/threonine kinase activity; receptor binding

Biological Process: heart morphogenesis; extracellular matrix organization and biogenesis; catagen; collagen fibril organization; heart development; SMAD protein nuclear translocation; dopamine biosynthetic process; protein amino acid phosphorylation; cell-cell signaling; hair follicle development; transforming growth factor beta receptor signaling pathway; somatic stem cell division; cell growth; cell cycle arrest; embryonic gut development; cartilage condensation; response to drug; platelet activation; neutrophil chemotaxis; negative regulation of immune response; neuron fate commitment; positive regulation of cell cycle; positive regulation of catagen; positive regulation of cell growth; positive regulation of phosphoinositide 3-kinase cascade; cardioblast differentiation; positive regulation of protein secretion; positive regulation of cell division; activation of protein kinase activity; neuron development; response to progesterone stimulus; positive regulation of heart contraction; cell death; axon guidance; positive regulation of immune response; wound healing; cell morphogenesis; cardiac muscle cell proliferation; positive regulation of stress-activated MAPK cascade; odontogenesis; negative regulation of cell proliferation; platelet degranulation; positive regulation of neuron apoptosis; positive regulation of cell proliferation; salivary gland morphogenesis; response to wounding; hemopoiesis; angiogenesis; positive regulation of integrin biosynthetic process; negative regulation of epithelial cell proliferation; uterine wall breakdown; intercellular junction assembly and maintenance; cell migration; regulation of transforming growth factor-beta2 production; hair follicle morphogenesis; positive regulation of cell adhesion mediated by integrin; glial cell migration; positive regulation of ossification; cell proliferation; embryonic development; eye development; generation of neurons; positive regulation of cardioblast differentiation; response to hypoxia; epithelial to mesenchymal transition; blood vessel remodeling; negative regulation of cell growth; blood coagulation

Disease: Loeys-dietz Syndrome 4

Research Articles on TGF b 2

Similar Products

Product Notes

The TGF b 2 tgfb2 (Catalog #AAA142317) is a Recombinant Protein produced from Nicotiana benthamiana and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: HHHHHH ALDAAYCFRN VQDNCCLRPL YIDFKRDLGW KWIHEPKGYN ANFCAGACPY LWSSDTQHSR VLSLYNTINP EASASPCCVS QDLEPLTI LYYIGKTPKI EQLSNMIVKS CKCS. It is sometimes possible for the material contained within the vial of "Transforming Growth Factor-Beta 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.