Transforming Growth Factor beta Induced Recombinant Protein | TGFB1I1 recombinant protein

Transforming Growth Factor beta Induced, Recombinant, Human (BIGH3, TGFBI, ig-h3)

Cat. Num. AAA650430

• Gene Names: TGFB1I1; HIC5; ARA55; HIC-5; TSC-5
• Purity: Highly Purified; 95% by SDS PAGE
• Synonyms: Transforming Growth Factor beta Induced; Recombinant; Human (BIGH3; TGFBI; ig-h3); TGFB1I1 recombinant protein

• Host: Human, Recombinant E Coli
• Purity/Purification: Highly Purified; 95% by SDS PAGE
• Form/Format: Supplied as a liquid in 20mM Tris-HCl, pH 8.0
• Sequence: MGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVF; APTNEAFRALPPRERSRLLGDAKELANILKYHIGDEILV; SGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDI; MATNGVVHVITNVLQPPA

• Preparation and Storage: May be stored at 4 degree C for short-term only. For long-term storage, store at -20 degree C. Aliquots are stable for at least 6 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Related Product Information for TGFB1I1 recombinant protein

BIGH3, also known as TGFBI and ig-h3, is an extracellular matrix protein induced by transforming growth factor(TGF)-beta 1. BIGH3 protein is involved in cell growth, cell differentiation, wound healing and cell adhesion. In addition, some missense mutations of BIGH3 were identified in families affected with human autosomal dominant corneal dystrophies. BIGH3 gene encodes for a 683 amino-acid protein containing an RGD motif and four internal repeated domains which have highly conserved sequences founded in several species (Fasciclin domain). Recombinant human BIGH3 protein (fourth FAS domain) was expressed in E. coli and purified by using conventional chromatography techniques.

Product Categories/Family for TGFB1I1 recombinant protein

Growth Factors; Cytokines; Growth Factors-TGF

NCBI and Uniprot Product Information

• NCBI GI #: 119572515
• NCBI GeneID: 7041
• UniProt Accession #: O43294; Q9BPW3; Q9Y2V5; B2R8D5
• Molecular Weight: 14.5kD (135 amino acids, residues 502-636)
• NCBI Official Full Name: transforming growth factor beta 1 induced transcript 1, isoform CRA_a
• NCBI Official Synonym Full Names: transforming growth factor beta 1 induced transcript 1
• NCBI Official Symbol: TGFB1I1
• NCBI Official Synonym Symbols: HIC5; ARA55; HIC-5; TSC-5
• NCBI Protein Information: transforming growth factor beta-1-induced transcript 1 protein; androgen receptor coactivator ARA55; hydrogen peroxide-inducible clone 5 protein; androgen receptor coactivator 55 kDa protein; androgen receptor-associated protein of 55 kDa
• UniProt Protein Name: Transforming growth factor beta-1-induced transcript 1 protein
• Protein Family: Transforming growth factor beta-1-induced transcript 1 protein
• UniProt Gene Name: TGFB1I1
• UniProt Synonym Gene Names: ARA55; Hic-5
• UniProt Entry Name: TGFI1_HUMAN

NCBI Description

This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

Function: Functions as a molecular adapter coordinating multiple protein-protein interactions at the focal adhesion complex and in the nucleus. Links various intracellular signaling modules to plasma membrane receptors and regulates the Wnt and TGFB signaling pathways. May also regulate SLC6A3 and SLC6A4 targeting to the plasma membrane hence regulating their activity. In the nucleus, functions as a nuclear receptor coactivator regulating glucocorticoid, androgen, mineralocorticoid and progesterone receptor transcriptional activity. May play a role in the processes of cell growth, proliferation, migration, differentiation and senescence. May have a zinc-dependent DNA-binding activity. Ref.1 Ref.7 Ref.15 Ref.17 Ref.19 Ref.20 Ref.24 Ref.26 Ref.28 Ref.30 Ref.32 Ref.33 Ref.34 Ref.36 Ref.37

Subunit structure: Homooligomer. Interacts with CRIP2, HSPB1, ILK, LIMS1, LIMS2, NCK2, NUDT16L1, PAK, PPARG, PTPN12, TCF3, TCF7L2 and VCL. Forms a complex with GIT1 and ARHGEF7

By similarity. Interacts with AR/androgen receptor in a ligand-dependent manner. Interacts with CSK, LYN, MAPK15, NR3C1, PPARG, PTK2/FAK1, PTK2B/PYK2, SLC6A3, SLC6A4, SMAD3, SRC and talin. Ref.1 Ref.6 Ref.8 Ref.9 Ref.10 Ref.12 Ref.18 Ref.19 Ref.20 Ref.21 Ref.24 Ref.26 Ref.27 Ref.28 Ref.29 Ref.32 Ref.33 Ref.35 Ref.36

Subcellular location: Cell junction › focal adhesion. Nucleus matrix. Cytoplasm › cytoskeleton. Note: Associated with the actin cytoskeleton; colocalizes with stress fibers. Ref.9 Ref.12 Ref.13 Ref.20 Ref.23 Ref.26 Ref.30 Ref.37

Tissue specificity: Expressed in platelets, smooth muscle and prostate stromal cells (at protein level). Ref.1 Ref.9 Ref.11 Ref.12 Ref.22 Ref.25 Ref.30 Ref.36 Ref.37

Induction: Up-regulated by TNF and hydrogen peroxide. Ref.14 Ref.16

Domain: The LIM zinc-binding domains mediate glucocorticoid receptor coactivation and interaction with AR, CRIP2, ILK, LIMS1, NR3C1, PPARG, TCF3, TCF7L2, SLC6A3 and SMAD3. The LIM zinc-binding 2 and LIM zinc-binding 3 domains mediate targeting to focal adhesions and actin stress fibers. The LIM zinc-binding 3 and LIM zinc-binding 4 domains mediate interaction with TRAF4 and MAPK15. The LIM zinc-binding 4 domain mediates interaction with HSPB1, homooligomerization and targeting to the nuclear matrix. The LIM zinc-binding 3 domain mediates interaction with PTPN12.The LD (leucine and aspartate-rich) motif 3 mediates interaction with GIT1 and functions as a nuclear export signal.

Post-translational modification: Phosphorylated by gonadotropin-releasing hormone-activated SRC. Ref.10 Ref.12 Ref.19 Ref.35 Ref.36

Sequence similarities: Belongs to the paxillin family.Contains 4 LIM zinc-binding domains.

Sequence caution: The sequence AAH32545.1 differs from that shown. Reason: Erroneous initiation.