Trefoil Factor 3 (TFF3) Recombinant Protein | TFF3 recombinant protein
Recombinant Human Trefoil Factor 3 (TFF3), Partial
Gene Names
TFF3; ITF; P1B; TFI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Trefoil Factor 3 (TFF3); Recombinant Human Trefoil Factor 3 (TFF3); Partial; Intestinal trefoil factor; hITF; Polypeptide P1.B; hP1.B; ITF; TFI; TFF3 recombinant protein
Host
Yeast
Specificity
Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus. Also expressed in the hypothalamus where it is detected in paraventricular, periventricular and supraoptic nuclei (at protein level).
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-80aa; Partial
Sequence
LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV
Sequence Length
94
Species
Human
Tag
N-terminal 6xHis-tagged
Subcellular Location
Secreted, Extracellular Space, Extracellular Matrix, Cytoplasm
Production Note
Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for TFF3 recombinant protein
Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).
Product Categories/Family for TFF3 recombinant protein
References
"The three human trefoil genes TFF1, TFF2, and TFF3 are located within a region of 55 kb on chromosome 21q22.3." Seib T., Blin N., Hilgert K., Seifert M., Theisinger B., Engel M., Dooley S., Zang K.D., Welter C. Genomics 40:200-202(1997).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.2 kDa
NCBI Official Full Name
trefoil factor 3
NCBI Official Synonym Full Names
trefoil factor 3
NCBI Official Symbol
TFF3
NCBI Official Synonym Symbols
ITF; P1B; TFI
NCBI Protein Information
trefoil factor 3
UniProt Protein Name
Trefoil factor 3
Protein Family
UniProt Gene Name
TFF3
UniProt Synonym Gene Names
ITF; TFI; hITF; hP1.B
UniProt Entry Name
TFF3_HUMAN
NCBI Description
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008]
Uniprot Description
TFF3: Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 21q22.3
Cellular Component: proteinaceous extracellular matrix; extracellular region; secretory granule
Biological Process: response to peptide hormone stimulus; digestion; defense response
Research Articles on TFF3
Similar Products
Product Notes
The TFF3 tff3 (Catalog #AAA7115263) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-80aa; Partial. The amino acid sequence is listed below: LLSSSSAEEY VGLSANQCAV PAKDRVDCGY PHVTPKECNN RGCCFDSRIP GV. It is sometimes possible for the material contained within the vial of "Trefoil Factor 3 (TFF3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
