Trefoil factor 2 (TFF2) Recombinant Protein | TFF2 recombinant protein
Recombinant Dog Trefoil factor 2 (TFF2)
Gene Names
TFF2; SP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Trefoil factor 2 (TFF2); Recombinant Dog Trefoil factor 2 (TFF2); TFF2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-129, Full length protein
Sequence
QKPSACQCSRIEASHRKNCGFPGISASECFNTGCCFDSRVPNVPWCFHPLPKQESEQCVMEVAARKNCGYPGISPQECASRNCCFSDTIRNVPWCFFPILNQDCHY
Sequence Length
106
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for TFF2 recombinant protein
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,102 Da
NCBI Official Full Name
trefoil factor 2
NCBI Official Synonym Full Names
trefoil factor 2
NCBI Official Symbol
TFF2
NCBI Official Synonym Symbols
SP
NCBI Protein Information
trefoil factor 2
UniProt Protein Name
Trefoil factor 2
Protein Family
UniProt Gene Name
TFF2
Uniprot Description
Inhibits gastrointestinal motility and gastric acid secretion. Could function as a structural component of gastric mucus, possibly by stabilizing glycoproteins in the mucus gel through interactions with carbohydrate side chains ().
Similar Products
Product Notes
The TFF2 tff2 (Catalog #AAA1437666) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-129, Full length protein. The amino acid sequence is listed below: QKPSACQCSR IEASHRKNCG FPGISASECF NTGCCFDSRV PNVPWCFHPL PKQESEQCVM EVAARKNCGY PGISPQECAS RNCCFSDTIR NVPWCFFPIL NQDCHY. It is sometimes possible for the material contained within the vial of "Trefoil factor 2 (TFF2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
