Trans-2,3-enoyl-CoA reductase-like (Tecrl) Recombinant Protein | Tecrl recombinant protein
Recombinant Mouse Trans-2,3-enoyl-CoA reductase-like (Tecrl)
Gene Names
Tecrl; Srd5a2l2; D330017N19Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Trans-2; 3-enoyl-CoA reductase-like (Tecrl); Recombinant Mouse Trans-2; Tecrl recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-361aa; full length protein
Sequence
MFKRHKSLERKRELLFQGLPQSTMKNNARNFHSLSQLVLSAGPLKTTTAVKHSKTTHFEI EILDAHTRKQICIVDKVTQTSTIHDVKQKFHKACPKWYPSRIGLQLEYGGPYLRDYITVQ SVAASSIITLYFTDLGQQVGWTTVFLAEYSGPLLIYLLFYLRSSYIYDVKESTRWPRHPV VHLAFFCHCIHYIRLLLETLFVHKVSTGHSPMKNLIKGCAFYWGFTSWMAYYINHPRYTP PSFGNRQVIVSAINFLFCEAGNHFINTVLAHPNHTGSNACFPSPNYNPFTWLFFLVSCPN YTYEIGSWISFTVMTQTLPVGIFTILMTIQMSLWARKKHKIYRKKFNSYVHRKSAIIPLI L
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Tecrl recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,893 Da
NCBI Official Full Name
trans-2,3-enoyl-CoA reductase-like
NCBI Official Synonym Full Names
trans-2,3-enoyl-CoA reductase-like
NCBI Official Symbol
Tecrl
NCBI Official Synonym Symbols
Srd5a2l2; D330017N19Rik
NCBI Protein Information
trans-2,3-enoyl-CoA reductase-like
UniProt Protein Name
Trans-2,3-enoyl-CoA reductase-like
Protein Family
UniProt Gene Name
Tecrl
UniProt Synonym Gene Names
Srd5a2l2
UniProt Entry Name
TECRL_MOUSE
Uniprot Description
TECRL: Belongs to the steroid 5-alpha reductase family.
Protein type: EC 1.3.1.-; Membrane protein, multi-pass; Membrane protein, integral
Cellular Component: cytoplasm; integral to membrane; membrane
Molecular Function: 2,3-dihydroxy-2,3-dihydro-phenylpropionate dehydrogenase activity; 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase activity; cinnamate reductase activity; cis-2,3-dihydrodiol DDT dehydrogenase activity; cis-chlorobenzene dihydrodiol dehydrogenase activity; enoyl-[acyl-carrier-protein] reductase activity; oxidoreductase activity; oxidoreductase activity, acting on the CH-CH group of donors; trans-1,2-dihydrodiolphenanthrene dehydrogenase activity; trans-9R,10R-dihydrodiolphenanthrene dehydrogenase activity
Biological Process: lipid metabolic process
Similar Products
Product Notes
The Tecrl tecrl (Catalog #AAA7031158) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-361aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Tecrl tecrl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MFKRHKSLER KRELLFQGLP QSTMKNNARN FHSLSQLVLS AGPLKTTTAV KHSKTTHFEI EILDAHTRKQ ICIVDKVTQT STIHDVKQKF HKACPKWYPS RIGLQLEYGG PYLRDYITVQ SVAASSIITL YFTDLGQQVG WTTVFLAEYS GPLLIYLLFY LRSSYIYDVK ESTRWPRHPV VHLAFFCHCI HYIRLLLETL FVHKVSTGHS PMKNLIKGCA FYWGFTSWMA YYINHPRYTP PSFGNRQVIV SAINFLFCEA GNHFINTVLA HPNHTGSNAC FPSPNYNPFT WLFFLVSCPN YTYEIGSWIS FTVMTQTLPV GIFTILMTIQ MSLWARKKHK IYRKKFNSYV HRKSAIIPLI L. It is sometimes possible for the material contained within the vial of "Trans-2,3-enoyl-CoA reductase-like (Tecrl), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
