Teratocarcinoma-derived growth factor 1 Recombinant Protein | TDGF1 recombinant protein

Recombinant Human Teratocarcinoma-derived growth factor 1

Cat. Num. AAA717357

• Gene Names: TDGF1; CR; CRGF; CRIPTO
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Teratocarcinoma-derived growth factor 1; Recombinant Human Teratocarcinoma-derived growth factor 1; Cripto-1 growth factor; CRGF; Epidermal growth factor-like cripto protein CR1; TDGF1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 32-150aa; Partial
• Sequence: GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD
• Sequence Length: 172

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for TDGF1 recombinant protein

Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.

Product Categories/Family for TDGF1 recombinant protein

Developmental Biology

References

Molecular characterization of a gene of the 'EGF family' expressed in undifferentiated human NTERA2 teratocarcinoma cells.Ciccodicola A., Dono R., Obici S., Zollo M., Persico M.G.EMBO J. 8:1987-1991(1989) Isolation and characterization of the CRIPTO autosomal gene and its X-linked related sequence.Dono R., Montuori N., Rocchi M., de Ponti-Zilli L., Ciccodicola A., Persico M.G.Am. J. Hum. Genet. 49:555-565(1991) The DNA sequence, annotation and analysis of human chromosome 3.Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.Nature 440:1194-1198(2006) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. Signal peptide prediction based on analysis of experimentally verified cleavage sites.Zhang Z., Henzel W.J.Protein Sci. 13:2819-2824(2004) Cripto-1 activates nodal- and ALK4-dependent and -independent signaling pathways in mammary epithelial Cells.Bianco C., Adkins H.B., Wechselberger C., Seno M., Normanno N., De Luca A., Sun Y., Khan N., Kenney N., Ebert A., Williams K.P., Sanicola M., Salomon D.S.Mol. Cell. Biol. 22:2586-2597(2002) The CRIPTO/FRL-1/CRYPTIC (CFC) domain of human Cripto.Foley S.F., Van Vlijmen H.W., Boynton R.E., Adkins H.B., Cheung A.E., Singh J., Sanicola M., Young C.N., Wen D.Eur. J. Biochem. 270:3610-3618(2003) Characterization of the glycosylphosphatidylinositol-anchor signal sequence of human Cryptic with a hydrophilic extension.Watanabe K., Nagaoka T., Strizzi L., Mancino M., Gonzales M., Bianco C., Salomon D.S.Biochim. Biophys. Acta 1778:2671-2681(2008) CRIPTO3, a presumed pseudogene, is expressed in cancer.Sun C., Orozco O., Olson D.L., Choi E., Garber E., Tizard R., Szak S., Sanicola M., Carulli J.P.Biochem. Biophys. Res. Commun. 377:215-220(2008)

NCBI and Uniprot Product Information

• NCBI GI #: 292494883
• NCBI GeneID: 6997
• NCBI Accession #: NP_001167607.1
• NCBI GenBank Nucleotide #: NM_001174136.1
• UniProt Accession #: P13385; Q8TCC1
• Molecular Weight: 40.5 kDa
• NCBI Official Full Name: teratocarcinoma-derived growth factor 1 isoform 2
• NCBI Official Synonym Full Names: teratocarcinoma-derived growth factor 1
• NCBI Official Symbol: TDGF1
• NCBI Official Synonym Symbols: CR; CRGF; CRIPTO
• NCBI Protein Information: teratocarcinoma-derived growth factor 1
• UniProt Protein Name: Teratocarcinoma-derived growth factor 1
• Protein Family: Teratocarcinoma-derived growth factor
• UniProt Gene Name: TDGF1
• UniProt Synonym Gene Names: CRIPTO; CRGF
• UniProt Entry Name: TDGF1_HUMAN

NCBI Description

This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Uniprot Description

TDGF1: Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm. Interacts with the activin type-1 receptor ACVR1B. Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. Expressed in breast and lung.

Protein type: Cell adhesion; Membrane protein, peripheral; Motility/polarity/chemotaxis; Membrane protein, GPI anchor; Cell cycle regulation

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: apical plasma membrane; cell surface; extracellular space; extrinsic to plasma membrane; Golgi apparatus; lipid raft; nucleus; perinuclear region of cytoplasm; plasma membrane

Molecular Function: growth factor activity; protein binding; receptor binding

Biological Process: activation of MAPK activity; BMP signaling pathway; cardiac muscle cell differentiation; cell differentiation; cell migration during sprouting angiogenesis; determination of anterior/posterior axis, embryo; embryonic development; epidermal growth factor receptor signaling pathway; gastrulation; heart development; in utero embryonic development; mammary gland development; morphogenesis of a branching structure; negative regulation of apoptosis; negative regulation of transforming growth factor beta receptor signaling pathway; peptidyl-serine phosphorylation; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of cell-matrix adhesion; positive regulation of fibroblast proliferation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of transcription from RNA polymerase II promoter; regulation of signal transduction; somatic stem cell maintenance; vasculogenesis; Wnt receptor signaling pathway through beta-catenin