Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Translationally-controlled tumor protein homolog (Tctp) Recombinant Protein | Tctp recombinant protein

Recombinant Anopheles gambiae Translationally-controlled tumor protein homolog (Tctp)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Translationally-controlled tumor protein homolog (Tctp); Recombinant Anopheles gambiae Translationally-controlled tumor protein homolog (Tctp); Tctp recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-171, full length protein
Sequence
MKIWKDVFTGDEMFSDTYKVKLVDDVMYEVYGKHVSRTLGDVQLDGANPSAEEAEEGTESATESGVDIVLNHRLVETGFSDKKQFTTYLKDYMKKLVTRLEEKSPGEVEVFKTNINKVMKDLLGRFKDLQFFTGESMDCEGLIAMLEYRDIDGESVPVLLCFKHGLEEEKF
Sequence Length
171
Species
Anopheles gambiae (African malaria mosquito)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,547 Da
NCBI Official Full Name
AGAP002667-PA
NCBI Official Symbol
TCTP_ANOGA
NCBI Protein Information
AGAP002667-PA
UniProt Protein Name
Translationally-controlled tumor protein homolog
UniProt Gene Name
Tctp
UniProt Synonym Gene Names
TCTP

Uniprot Description

Involved in calcium binding and microtubule stabilization.

Similar Products

Product Notes

The Tctp tctp (Catalog #AAA1445103) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-171, full length protein. The amino acid sequence is listed below: MKIWKDVFTG DEMFSDTYKV KLVDDVMYEV YGKHVSRTLG DVQLDGANPS AEEAEEGTES ATESGVDIVL NHRLVETGFS DKKQFTTYLK DYMKKLVTRL EEKSPGEVEV FKTNINKVMK DLLGRFKDLQ FFTGESMDCE GLIAMLEYRD IDGESVPVLL CFKHGLEEEK F. It is sometimes possible for the material contained within the vial of "Translationally-controlled tumor protein homolog (Tctp), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual