Transcription elongation factor A protein-like 7 (Tceal7) Recombinant Protein | Tceal7 recombinant protein
Recombinant Mouse Transcription elongation factor A protein-like 7 (Tceal7)
Gene Names
Tceal7; 1110018P05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription elongation factor A protein-like 7 (Tceal7); Recombinant Mouse Transcription elongation factor A protein-like 7 (Tceal7); Tceal7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-98, Full length protein
Sequence
MQKSCNEKEGKPKGSEAKREDEQPCGALEGQRLEGNFRQRLLQSLEEFKEDIDYRHFKGEEMTGEEEEMERCLEEIRSLRKKFRALHSNRTHSRDHPF
Sequence Length
98
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,697 Da
NCBI Official Full Name
transcription elongation factor A protein-like 7
NCBI Official Synonym Full Names
transcription elongation factor A (SII)-like 7
NCBI Official Symbol
Tceal7
NCBI Official Synonym Symbols
1110018P05Rik
NCBI Protein Information
transcription elongation factor A protein-like 7
UniProt Protein Name
Transcription elongation factor A protein-like 7
Protein Family
UniProt Gene Name
Tceal7
UniProt Synonym Gene Names
TCEA-like protein 7
Uniprot Description
Plays a role in the negative regulation of NF-kappa-B signaling at the basal level by modulating transcriptional activity of NF-kappa-B on its target gene promoters. Associates with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. Regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines ().
Research Articles on Tceal7
Similar Products
Product Notes
The Tceal7 tceal7 (Catalog #AAA1252976) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-98, Full length protein. The amino acid sequence is listed below: MQKSCNEKEG KPKGSEAKRE DEQPCGALEG QRLEGNFRQR LLQSLEEFKE DIDYRHFKGE EMTGEEEEME RCLEEIRSLR KKFRALHSNR THSRDHPF. It is sometimes possible for the material contained within the vial of "Transcription elongation factor A protein-like 7 (Tceal7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
