Threonine aspartase 1 (Tasp1) Recombinant Protein | Tasp1 recombinant protein
Recombinant Mouse Threonine aspartase 1 (Tasp1)
Gene Names
Tasp1; AW986064; 4930485D02Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Threonine aspartase 1 (Tasp1); Recombinant Mouse Threonine aspartase 1 (Tasp1); Tasp1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-233, full length protein
Sequence
MIMEKGMNSGEGLPSRSSQASAAKVTVKELETQQPCKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQKAIEKLQAGALATDAVAAALVELEDSPFTNAGIGSNLNLLGEIECDASIMDGKSLNFGAVGALSGIKNPVSVAHRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPSTMTTRFSLAAFKRNKRKLELAERVETDFIQLKRRRQSSAKENDSGTLD
Sequence Length
233
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Tasp1 recombinant protein
This gene encodes an endopeptidase that cleaves specific substrates following aspartate residues. The encoded protein undergoes posttranslational autoproteolytic processing to generate alpha and beta subunits, which reassemble into the active alpha2-beta2 heterotetramer. It is required to cleave MLL, a protein required for the maintenance of HOX gene expression, and TFIIA, a basal transcription factor. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,545 Da
NCBI Official Full Name
threonine aspartase 1 isoform a
NCBI Official Synonym Full Names
taspase, threonine aspartase 1
NCBI Official Symbol
Tasp1
NCBI Official Synonym Symbols
AW986064; 4930485D02Rik
NCBI Protein Information
threonine aspartase 1
UniProt Protein Name
Threonine aspartase 1
Protein Family
UniProt Gene Name
Tasp1
UniProt Synonym Gene Names
Taspase-1
Uniprot Description
Protease involved in KMT2A/MLL1 processing and, consequently, in the correct expression of the early HOXA gene cluster.
Research Articles on Tasp1
Similar Products
Product Notes
The Tasp1 tasp1 (Catalog #AAA1418443) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-233, full length protein. The amino acid sequence is listed below: MIMEKGMNSG EGLPSRSSQA SAAKVTVKEL ETQQPCKEKR GGFVLVHAGA GYHSESKAKE YKHVCKRACQ KAIEKLQAGA LATDAVAAAL VELEDSPFTN AGIGSNLNLL GEIECDASIM DGKSLNFGAV GALSGIKNPV SVAHRLLCEG QKGKLSAGRI PPCFLVGEGA YRWAVDHGIP SCPPSTMTTR FSLAAFKRNK RKLELAERVE TDFIQLKRRR QSSAKENDSG TLD. It is sometimes possible for the material contained within the vial of "Threonine aspartase 1 (Tasp1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
