Translocated actin-recruiting phosphoprotein (tarP), partial Recombinant Protein | CT456 recombinant protein
Recombinant Chlamydia trachomatis Translocated actin-recruiting phosphoprotein (tarP), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Translocated actin-recruiting phosphoprotein (tarP); partial; Recombinant Chlamydia trachomatis Translocated actin-recruiting phosphoprotein (tarP); Recombinant Translocated actin-recruiting phosphoprotein (tarP); Translocated actin-recruiting phosphoprotein; Tarp protein; CT456 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-332, Fragment at the N-terminal.
Sequence
MTNSISGYQPTVTTSTSSTTSASGASGSLGASSVSTTANATVTQTANATNSAATSSIQTTGETVVNYTNSASAPNVTVSTSSSSTQATATSNKTSQAVAGKITSPDTSESSETSSTSSSDHIPSDYDDVGSNSGDISNNYDDVGSNNGDISSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSDGAAAAALNSLRGSSYTTGPRNEGVFGPGPEGLPDMSLPSYDPTNK
Sequence Length
332
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102,132 Da
NCBI Official Full Name
hypothetical protein CT456
NCBI Official Symbol
CT456
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Translocated actin-recruiting phosphoprotein
UniProt Gene Name
tarP
UniProt Synonym Gene Names
Tarp protein
UniProt Entry Name
TARP_CHLTR
Uniprot Description
Function: Appears to initiate or participate in signaling events that regulate the actin recruitment, which ultimately leads to internalization
By similarity.
Subcellular location: Secreted. Note: Secreted via type III secretion system and translocated into host cell
By similarity.
Post-translational modification: Phosphorylated on a tyrosine on attachment to the host cell. Tyrosine phosphorylation is temporally and spatially associated with recruitment of actin to the site of chlamydial entry. Phosphorylated Tarp seems to remain cytoplasmically exposed on the inclusion membrane at one side of internalized elementary bodies for several hours after entry
By similarity.
Sequence similarities: Belongs to the chlamydial CPn_0572/CT_456/TC_0741 family.
Similar Products
Product Notes
The CT456 tarp (Catalog #AAA1032249) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-332, Fragment at the N-terminal. The amino acid sequence is listed below: MTNSISGYQP TVTTSTSSTT SASGASGSLG ASSVSTTANA TVTQTANATN SAATSSIQTT GETVVNYTNS ASAPNVTVST SSSSTQATAT SNKTSQAVAG KITSPDTSES SETSSTSSSD HIPSDYDDVG SNSGDISNNY DDVGSNNGDI SSNYDDAAAD YEPIRTTENI YESIGGSRTS GPENTSGGAA AALNSLRGSS YSNYDDAAAD YEPIRTTENI YESIGGSRTS GPENTSGGAA AALNSLRGSS YSNYDDAAAD YEPIRTTENI YESIGGSRTS GPENTSDGAA AAALNSLRGS SYTTGPRNEG VFGPGPEGLP DMSLPSYDPT NK . It is sometimes possible for the material contained within the vial of "Translocated actin-recruiting phosphoprotein (tarP), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
