TRAF family member-associated NF-kappa-B activator Recombinant Protein | TANK recombinant protein

Recombinant Human TRAF family member-associated NF-kappa-B activator

Cat. Num. AAA1265413

• Gene Names: TANK; ITRAF; TRAF2; I-TRAF
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: TRAF family member-associated NF-kappa-B activator; Recombinant Human TRAF family member-associated NF-kappa-B activator; TRAF-interacting protein; I-TRAF; TANK recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-119aa; Partial
• Sequence: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPR
• Sequence Length: 425

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for TANK recombinant protein

Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining th in a latent state. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. May control negatively TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2.

Product Categories/Family for TANK recombinant protein

Signal Transduction

References

I-TRAF is a novel TRAF-interacting protein that regulates TRAF-mediated signal transduction.Rothe M., Xiong J., Shu H.-B., Williamson K., Goddard A., Goeddel D.V.Proc. Natl. Acad. Sci. U.S.A. 93:8241-8246(1996)

NCBI and Uniprot Product Information

• NCBI GI #: 312433953
• NCBI GeneID: 10010
• NCBI Accession #: NP_001186064.1
• NCBI GenBank Nucleotide #: NM_001199135.1
• UniProt Accession #: Q92844; Q7Z4J6; Q92885; D3DPB5
• Molecular Weight: 15.8 kDa
• NCBI Official Full Name: TRAF family member-associated NF-kappa-B activator isoform a
• NCBI Official Synonym Full Names: TRAF family member associated NFKB activator
• NCBI Official Symbol: TANK
• NCBI Official Synonym Symbols: ITRAF; TRAF2; I-TRAF
• NCBI Protein Information: TRAF family member-associated NF-kappa-B activator
• UniProt Protein Name: TRAF family member-associated NF-kappa-B activator
• Protein Family: TRAF family member-associated NF-kappa-B activator
• UniProt Gene Name: TANK
• UniProt Synonym Gene Names: ITRAF; TRAF2; I-TRAF
• UniProt Entry Name: TANK_HUMAN

NCBI Description

The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, thereby inhibiting TRAF function by sequestering the TRAFs in a latent state in the cytoplasm. For example, the protein encoded by this gene can block TRAF2 binding to LMP1, the Epstein-Barr virus transforming protein, and inhibit LMP1-mediated NF-kappa-B activation. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

TANK: Acts as a regulator of TRAF function by maintaining them in a latent state. Overexpression inhibits TRAF2-mediated NF- kappa-B activation signaled by CD40, TNFR1 and TNFR2. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. May be involved in I-kappa-B-kinase (IKK) regulation; may function as an adapter for kinases such as TBK1 or IKBKE that can modulate IKK activity. Interacts with TBK1 (via TRAF-C domain). Interacts with TRAF1 (via TRAF-C domain). Interacts with TRAF2 (via TRAF-C domain); the interaction is disrupted by the phosphorylation of TANK by IKBKE. Interacts with TRAF3 (via TRAF-C domain); the interaction with TRAF3 is weaker than the interactions with TRAF1 and TRAF3. Interacts with IKBKG; the interaction is enhanced by IKBKE and TBK1. Part of a ternary complex consisting of TANK, IKBKB and IKBKG. Ubiquitous. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 2q24.2

Cellular Component: cytoplasm; cytosol

Molecular Function: metal ion binding; protein binding; ubiquitin protein ligase binding

Biological Process: I-kappaB kinase/NF-kappaB cascade; innate immune response; MyD88-independent toll-like receptor signaling pathway; signal transduction; toll-like receptor 3 signaling pathway; toll-like receptor 4 signaling pathway; toll-like receptor signaling pathway