Transcription initiation factor TFIID subunit 11 (Taf11) Recombinant Protein | Taf11 recombinant protein
Recombinant Drosophila melanogaster Transcription initiation factor TFIID subunit 11 (Taf11)
Gene Names
Taf11; CG4079; d30beta; DmelCG4079; dTAFII30; dTAFII30 beta; dTAFII30beta; dTAF[[II]]30; dTAF[[II]]30beta; TAF; TAF11; TAF30b; Taf30beta; TAF30beta; TAF[II]30beta; TAF[[II]]; Taf[[II]]30beta; TAF[[II]]30beta; TFIID; TFIID 28 beta; TFIID-p28beta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription initiation factor TFIID subunit 11 (Taf11); Recombinant Drosophila melanogaster Transcription initiation factor TFIID subunit 11 (Taf11); Recombinant Transcription initiation factor TFIID subunit 11 (Taf11); Transcription initiation factor TFIID subunit 11; TAFII30 beta Transcription initiation factor TFIID 28 kDa subunit beta; p28-beta; Taf11 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-196aa; full length protein
Sequence
MDEILFPTQQKSNSLSDGDDVDLKFFQSASGERKDSDTSDPGNDADRDGKDADGDNDNKN TDGDGDSGEPAHKKLKTKKELEEEERERMQVLVSNFTEEQLDRYEMYRRSAFPKAAVKRL MQTITGCSVSQNVVIAMSGIAKVFVGEVVEEALDVMEAQGESGALQPKFIREAVRRLRTK DRMPIGRYQQPYFRLN
Sequence Length
196
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,091 Da
NCBI Official Full Name
TBP-associated factor 11
NCBI Official Synonym Full Names
TBP-associated factor 11
NCBI Official Symbol
Taf11
NCBI Official Synonym Symbols
CG4079; d30beta; DmelCG4079; dTAFII30; dTAFII30 beta; dTAFII30beta; dTAF[[II]]30; dTAF[[II]]30beta; TAF; TAF11; TAF30b; Taf30beta; TAF30beta; TAF[II]30beta; TAF[[II]]; Taf[[II]]30beta; TAF[[II]]30beta; TFIID; TFIID 28 beta; TFIID-p28beta
NCBI Protein Information
CG4079 gene product from transcript CG4079-RA; CG4079-PA; TBP-associated factor; TBP-associated factor 11; TBP-associated factor 30kD subunit beta; Taf11-PA
UniProt Protein Name
Transcription initiation factor TFIID subunit 11
Protein Family
UniProt Gene Name
Taf11
UniProt Synonym Gene Names
TAF30-BETA; p28-beta
UniProt Entry Name
TAF11_DROME
Uniprot Description
Function: TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors.
Subunit structure: Belongs to the TFIID complex which is composed of TATA binding protein (Tbp) and a number of TBP-associated factors (TAFs). Interacts with Taf2 and Taf4. Ref.1
Subcellular location: Nucleus.
Sequence similarities: Belongs to the TAF11 family.
Similar Products
Product Notes
The Taf11 taf11 (Catalog #AAA1156573) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-196aa; full length protein. The amino acid sequence is listed below: MDEILFPTQQ KSNSLSDGDD VDLKFFQSAS GERKDSDTSD PGNDADRDGK DADGDNDNKN TDGDGDSGEP AHKKLKTKKE LEEEERERMQ VLVSNFTEEQ LDRYEMYRRS AFPKAAVKRL MQTITGCSVS QNVVIAMSGI AKVFVGEVVE EALDVMEAQG ESGALQPKFI REAVRRLRTK DRMPIGRYQQ PYFRLN. It is sometimes possible for the material contained within the vial of "Transcription initiation factor TFIID subunit 11 (Taf11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
