Synaptotagmin-2 Recombinant Protein | Syt2 recombinant protein

Synaptotagmin-2

Cat. Num. AAA7043415

• Gene Names: Syt2; IP4BP; R74640; mKIAA4194
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Synaptotagmin-2; Syt2 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-422aa; full length protein
• Sequence: MRNIFKRNQEPNVAPATTTATMPLAPVAPADNSTESTGPGESQEDMFAKLKEKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELAGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK
• Sequence Length: Full Length Protein

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Syt2 recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for Syt2 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 31543797
• NCBI GeneID: 20980
• NCBI Accession #: NP_033333.2
• NCBI GenBank Nucleotide #: NM_009307.3
• UniProt Accession #: P46097; Q8R0E1
• Molecular Weight: 47,263 Da
• NCBI Official Full Name: synaptotagmin-2
• NCBI Official Synonym Full Names: synaptotagmin II
• NCBI Official Symbol: Syt2
• NCBI Official Synonym Symbols: IP4BP; R74640; mKIAA4194
• NCBI Protein Information: synaptotagmin-2
• UniProt Protein Name: Synaptotagmin-2
• Protein Family: Synaptotagmin
• UniProt Gene Name: Syt2
• UniProt Synonym Gene Names: SytII
• UniProt Entry Name: SYT2_MOUSE

Uniprot Description

SYT2: May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. Belongs to the synaptotagmin family.

Protein type: Membrane protein, integral; Calcium-binding; Vesicle; Lipid-binding

Cellular Component: axon; intracellular membrane-bound organelle; plasma membrane; synaptic vesicle membrane; terminal button

Molecular Function: calcium ion binding; calcium-dependent phospholipid binding; clathrin binding; inositol 1,3,4,5 tetrakisphosphate binding; protein binding; syntaxin binding

Biological Process: calcium ion-dependent exocytosis of neurotransmitter; regulation of calcium ion-dependent exocytosis; synaptic vesicle endocytosis; vesicle fusion