Synaptotagmin-15 Recombinant Protein | Syt15 recombinant protein

Synaptotagmin-15

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Synaptotagmin-15; Syt15 recombinant protein

Ordering
Cat. Num. AAA7043414 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

Cell Free Expression

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Liquid containing glycerol

Sequence Positions

1-422aa; full length protein

Sequence

MAEQLALVIGCIIGGLLLLIGISCCLWKRLCTTFTYEELPETADTATSSSFSKKEERPCRYAGIPSVRLPSVPFVVPPSHQGRDWVRLHGGDWAVAPQDPCPVPEHITCTSSPAAGQTSLPLCVMGSINPELYKSSEDVSEAGFPDGCLGRLWFSVEYQQESERLLVDLIKAQHLQVPAETCSTLVKLHLLPDKRRFLQSKAKRKTCNPQFDESFIFQVSSKSVAQRVLKFSVYHINKQRKHQLLGQVLFPLKNETLAGDRHRVIWRDLEAENLEPLSEFGDLQFCLSYNDYLSRLTVVVLRAKGLQLQEDRGVVSVFVKVSLMNHNKFVKCKRTSAVLGSVNPVYNETFSFKADANELDTASLSLVVLQITEGDKSYPLGRVVVGPYMYTRGKELEHWNEMLRKPKELVKRWHALCRPMEP

Sequence Length

Full Length Protein

Species

Rattus norvegicus (Rat)

Preparation and Storage

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Syt15 recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for Syt15 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

NCBI GI #

37999347

UniProt Accession #

P59926

Molecular Weight

47,592 Da

NCBI Official Full Name

Synaptotagmin-15

UniProt Protein Name

Synaptotagmin-15

Protein Family

Synaptotagmin

UniProt Gene Name

Syt15

UniProt Synonym Gene Names

Sytxv; SytXV

UniProt Entry Name

SYT15_RAT

Uniprot Description

SYT15: May be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues. Belongs to the synaptotagmin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Cellular Component: extrinsic to membrane; plasma membrane

Molecular Function: calcium ion binding; calcium-dependent phospholipid binding; clathrin binding; syntaxin binding

Biological Process: calcium ion-dependent exocytosis of neurotransmitter; regulation of calcium ion-dependent exocytosis; vesicle fusion

Similar Products

Product Notes

The Syt15 syt15 (Catalog #AAA7043414) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-422aa; full length protein. The amino acid sequence is listed below: MAEQLALVIG CIIGGLLLLI GISCCLWKRL CTTFTYEELP ETADTATSSS FSKKEERPCR YAGIPSVRLP SVPFVVPPSH QGRDWVRLHG GDWAVAPQDP CPVPEHITCT SSPAAGQTSL PLCVMGSINP ELYKSSEDVS EAGFPDGCLG RLWFSVEYQQ ESERLLVDLI KAQHLQVPAE TCSTLVKLHL LPDKRRFLQS KAKRKTCNPQ FDESFIFQVS SKSVAQRVLK FSVYHINKQR KHQLLGQVLF PLKNETLAGD RHRVIWRDLE AENLEPLSEF GDLQFCLSYN DYLSRLTVVV LRAKGLQLQE DRGVVSVFVK VSLMNHNKFV KCKRTSAVLG SVNPVYNETF SFKADANELD TASLSLVVLQ ITEGDKSYPL GRVVVGPYMY TRGKELEHWN EMLRKPKELV KRWHALCRPM EP. It is sometimes possible for the material contained within the vial of "Synaptotagmin-15, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...

Synaptotagmin-15 Recombinant Protein | Syt15 recombinant protein