Synaptotagmin-1 Recombinant Protein | SYT1 recombinant protein
Synaptotagmin-1
Gene Names
LOC100533340; p65; SYT1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Synaptotagmin-1; SYT1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-428aa; full length protein
Sequence
MDSLLARVKRAADADALNPAQEGVTGGPDAAGLPDVSTSSPGGGGAGDKLKEKMDEYKDKLINEIENLPIWAIVLIIAGSLLFLVCCVYCVCRRSCRKRKKKEGKKGLKGAVDLKSVQLLGNSYKEKVQPDLDELPVNMEDNEDAESTKSEVKLGKLQFSLDYDFQKGELSVNVIQAADLPGMDMSGTSDPYVKVYLLPDKKKKYETKVHRKTLNPVFNESFTFKVPYAEVGSKILTFAVYDFDRFSKHDQIGQVQVPLNSIDLGRVVEDWKDLQSPDTESEKENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIALLQGTKRLKKKKTTIKKNTLNPYFNESFGFEVPFEQIQKVTLIITVVDYDRIGTSEPIGRCVLGCNSSGTELRHWSDMLANPRRPIAQWHTLQEVPEKN
Sequence Length
Full Length Protein
Species
Aplysia californica (California sea hare)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for SYT1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for SYT1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47,754 Da
NCBI Official Full Name
synaptotagmin-1 isoform 1
NCBI Official Symbol
LOC100533340
NCBI Official Synonym Symbols
p65; SYT1
NCBI Protein Information
synaptotagmin-1
UniProt Protein Name
Synaptotagmin-1
Protein Family
UniProt Gene Name
SYT1
UniProt Entry Name
SY65_APLCA
Uniprot Description
Acts as inhibitor of neurotransmitter release. Overexpression leads to a decrease in the amplitude of the excitatory postsynaptic potential in dissected cholinergic and glutaminergic neurons while depletion with antisense oligonucleotides leads to an increase. Overexpression of isoform 1 blocks the reversal of synaptic depression by serotonin in sensory neurons.
Similar Products
Product Notes
The SYT1 syt1 (Catalog #AAA7043407) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-428aa; full length protein. The amino acid sequence is listed below: MDSLLARVKR AADADALNPA QEGVTGGPDA AGLPDVSTSS PGGGGAGDKL KEKMDEYKDK LINEIENLPI WAIVLIIAGS LLFLVCCVYC VCRRSCRKRK KKEGKKGLKG AVDLKSVQLL GNSYKEKVQP DLDELPVNME DNEDAESTKS EVKLGKLQFS LDYDFQKGEL SVNVIQAADL PGMDMSGTSD PYVKVYLLPD KKKKYETKVH RKTLNPVFNE SFTFKVPYAE VGSKILTFAV YDFDRFSKHD QIGQVQVPLN SIDLGRVVED WKDLQSPDTE SEKENKLGDI CFSLRYVPTA GKLTVVILEA KNLKKMDVGG LSDPYVKIAL LQGTKRLKKK KTTIKKNTLN PYFNESFGFE VPFEQIQKVT LIITVVDYDR IGTSEPIGRC VLGCNSSGTE LRHWSDMLAN PRRPIAQWHT LQEVPEKN. It is sometimes possible for the material contained within the vial of "Synaptotagmin-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
