Synaptophysin-like protein 1 (Sypl1) Recombinant Protein | Sypl recombinant protein
Recombinant Mouse Synaptophysin-like protein 1 (Sypl1)
Gene Names
Sypl; PanI; Pphn; Sypl1; AI314763; AI604763; D12Ertd446e
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Synaptophysin-like protein 1 (Sypl1); Recombinant Mouse Synaptophysin-like protein 1 (Sypl1); Recombinant Synaptophysin-like protein 1 (Sypl1); Synaptophysin-like protein 1; Pantophysin; Sypl recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-261
Sequence
MASKANMVRQRFSRLSQRMSAFQINLNPLKEPLGFIKILEWFASIFAFATCGGFKGKTEIQVNCPKVGVNKNQTVTATFGYPFRLNQASFHTPPNVSVCDVNWEKHVLIGDYSSSAQFYVTFAVFVFLYCIAALLLYVGYTNLYRDSRKLPMIDFIVTLVATFLWLVSSSAWAKALTDIKVATGHRIVEELEICNPESGVSCYFVSVTSMGSLNVSVIFGFLNMILWGGNAWFVYKETSLHSPSNTSASHSQGGGPPTSGM
Sequence Length
261
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28,899 Da
NCBI Official Full Name
synaptophysin-like protein 1 isoform 1
NCBI Official Synonym Full Names
synaptophysin-like protein
NCBI Official Symbol
Sypl
NCBI Official Synonym Symbols
PanI; Pphn; Sypl1; AI314763; AI604763; D12Ertd446e
NCBI Protein Information
synaptophysin-like protein 1; Pan I; pantophysin
UniProt Protein Name
Synaptophysin-like protein 1
UniProt Gene Name
Sypl1
UniProt Synonym Gene Names
Pphn; Sypl
UniProt Entry Name
SYPL1_MOUSE
Uniprot Description
SYPL1: Belongs to the synaptophysin/synaptobrevin family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Cellular Component: synaptic vesicle; membrane; integral to membrane; cytoplasmic vesicle; secretory granule; integral to synaptic vesicle membrane
Molecular Function: transporter activity
Biological Process: transport
Similar Products
Product Notes
The Sypl sypl1 (Catalog #AAA1126488) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-261. The amino acid sequence is listed below: MASKANMVRQ RFSRLSQRMS AFQINLNPLK EPLGFIKILE WFASIFAFAT CGGFKGKTEI QVNCPKVGVN KNQTVTATFG YPFRLNQASF HTPPNVSVCD VNWEKHVLIG DYSSSAQFYV TFAVFVFLYC IAALLLYVGY TNLYRDSRKL PMIDFIVTLV ATFLWLVSSS AWAKALTDIK VATGHRIVEE LEICNPESGV SCYFVSVTSM GSLNVSVIFG FLNMILWGGN AWFVYKETSL HSPSNTSASH SQGGGPPTSG M. It is sometimes possible for the material contained within the vial of "Synaptophysin-like protein 1 (Sypl1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
