Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Synaptophysin (SYP) Recombinant Protein | SYP recombinant protein

Recombinant Bovine Synaptophysin (SYP)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Synaptophysin (SYP); Recombinant Bovine Synaptophysin (SYP); Recombinant Synaptophysin (SYP); Synaptophysin; Major synaptic vesicle protein p38; SYP recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-313
Sequence
MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTKSDLNIEVEFEYPFRLHEVYFEAPTCQGDPKKIFLVGNYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKGMHVCHQPGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGQAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASSGGGGYGPQGDYGQQGYGPQGAPTSFSNQM
Sequence Length
313
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,910 Da
NCBI Official Full Name
synaptophysin
NCBI Official Synonym Full Names
synaptophysin<
NCBI Official Symbol
SYP
NCBI Protein Information
synaptophysin; major synaptic vesicle protein p38
UniProt Protein Name
Synaptophysin
Protein Family
UniProt Gene Name
SYP
UniProt Entry Name
SYPH_BOVIN

Uniprot Description

Function: Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity

By similarity.

Subunit structure: Homohexamer or homotetramer. Interacts with SRCIN1

By similarity.

Subcellular location: Cytoplasmic vesicle › secretory vesicle › synaptic vesicle membrane; Multi-pass membrane protein. Cell junction › synapse › synaptosome.

Tissue specificity: Characteristic of a type of small (30-80 nm) neurosecretory vesicles, including presynaptic vesicles, but also vesicles of various neuroendocrine cells of both neuronal and epithelial phenotype.

Domain: The calcium-binding activity is thought to be localized in the cytoplasmic tail of the protein.

Post-translational modification: Ubiquitinated; mediated by SIAH1 or SIAH2 and leading to its subsequent proteasomal degradation

By similarity.

Sequence similarities: Belongs to the synaptophysin/synaptobrevin family.Contains 1 MARVEL domain.

Sequence caution: The sequence AAA30767.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on SYP

Similar Products

Product Notes

The SYP syp (Catalog #AAA967648) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-313. The amino acid sequence is listed below: MLLLADMDVV NQLVAGGQFR VVKEPLGFVK VLQWVFAIFA FATCGSYSGE LQLSVDCANK TKSDLNIEVE FEYPFRLHEV YFEAPTCQGD PKKIFLVGNY SSSAEFFVTV AVFAFLYSMG ALATYIFLQN KYRENNKGPM LDFLATAVFA FMWLVSSSAW AKGLSDVKMA TDPENIIKGM HVCHQPGNTC KELRDPVTSG LNTSVVFGFL NLVLWVGNLW FVFKETGWAA PFLRAPPGAP EKQPAPGDAY GQAGYGQGPG GYGPQDSYGP QGGYQPDYGQ PASSGGGGYG PQGDYGQQGY GPQGAPTSFS NQM. It is sometimes possible for the material contained within the vial of "Synaptophysin (SYP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.