Syntabulin (SYBU) Recombinant Protein | SYBU recombinant protein
Recombinant Human Syntabulin (SYBU)
Gene Names
SYBU; OCSYN; SNPHL; GOLSYN
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Syntabulin (SYBU); Recombinant Human Syntabulin (SYBU); SYBU recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-663aa; full length protein
Sequence
MGPLRESKKEHRVQHHDKEISRSRIPRLILRPHMPQQQHKVSPASESPFSEEESREFNPS SSGRSARTVSSNSFCSDDTGCPSSQSVSPVKTPSDAGNSPIGFCPGSDEGFTRKKCTIGM VGEGSIQSSRYKKESKSGLVKPGSEADFSSSSSTGSISAPEVHMSTAGSKRSSSSRNRGP HGRSNGASSHKPGSSPSSPREKDLLSMLCRNQLSPVNIHPSYAPSSPSSSNSGSYKGSDC SPIMRRSGRYMSCGENHGVRPPNPEQYLTPLQQKEVTVRHLKTKLKESERRLHERESEIV ELKSQLARMREDWIEEECHRVEAQLALKEARKEIKQLKQVIETMRSSLADKDKGIQKYFV DINIQNKKLESLLQSMEMAHSGSLRDELCLDFPCDSPEKSLTLNPPLDTMADGLSLEEQV TGEGADRELLVGDSIANSTDLFDEIVTATTTESGDLELVHSTPGANVLELLPIVMGQEEG SVVVERAVQTDVVPYSPAISELIQSVLQKLQDPCPSSLASPDESEPDSMESFPESLSALV VDLTPRNPNSAILLSPVETPYANVDAEVHANRLMRELDFAACVEERLDGVIPLARGGVVR QYWSSSFLVDLLAVAAPVVPTVLWAFSTQRGGTDPVYNIGALLRGCCVVALHSLRRTAFR IKT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SYBU recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,368 Da
NCBI Official Full Name
syntabulin isoform b
NCBI Official Synonym Full Names
syntabulin
NCBI Official Symbol
SYBU
NCBI Official Synonym Symbols
OCSYN; SNPHL; GOLSYN
NCBI Protein Information
syntabulin
UniProt Protein Name
Syntabulin
Protein Family
UniProt Gene Name
SYBU
UniProt Synonym Gene Names
GOLSYN; KIAA1472
UniProt Entry Name
SYBU_HUMAN
NCBI Description
Syntabulin/GOLSYN is part of a kinesin motor-adaptor complex that is critical for the anterograde axonal transport of active zone components and contributes to activity-dependent presynaptic assembly during neuronal development (Cai et al., 2007 [PubMed 17611281]).[supplied by OMIM, Mar 2008]
Uniprot Description
SYBU: Part of a kinesin motor-adapter complex that is critical for the anterograde axonal transport of active zone components and contributes to activity-dependent presynaptic assembly during neuronal development. 5 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 8q23.2
Cellular Component: cytoplasmic membrane-bound vesicle; Golgi membrane; integral to membrane; intracellular membrane-bound organelle; microtubule; mitochondrion; nucleoplasm; vesicle
Molecular Function: kinesin binding; microtubule binding; protein binding; syntaxin-1 binding
Research Articles on SYBU
Similar Products
Product Notes
The SYBU sybu (Catalog #AAA7030726) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-663aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SYBU sybu for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGPLRESKKE HRVQHHDKEI SRSRIPRLIL RPHMPQQQHK VSPASESPFS EEESREFNPS SSGRSARTVS SNSFCSDDTG CPSSQSVSPV KTPSDAGNSP IGFCPGSDEG FTRKKCTIGM VGEGSIQSSR YKKESKSGLV KPGSEADFSS SSSTGSISAP EVHMSTAGSK RSSSSRNRGP HGRSNGASSH KPGSSPSSPR EKDLLSMLCR NQLSPVNIHP SYAPSSPSSS NSGSYKGSDC SPIMRRSGRY MSCGENHGVR PPNPEQYLTP LQQKEVTVRH LKTKLKESER RLHERESEIV ELKSQLARMR EDWIEEECHR VEAQLALKEA RKEIKQLKQV IETMRSSLAD KDKGIQKYFV DINIQNKKLE SLLQSMEMAH SGSLRDELCL DFPCDSPEKS LTLNPPLDTM ADGLSLEEQV TGEGADRELL VGDSIANSTD LFDEIVTATT TESGDLELVH STPGANVLEL LPIVMGQEEG SVVVERAVQT DVVPYSPAIS ELIQSVLQKL QDPCPSSLAS PDESEPDSME SFPESLSALV VDLTPRNPNS AILLSPVETP YANVDAEVHA NRLMRELDFA ACVEERLDGV IPLARGGVVR QYWSSSFLVD LLAVAAPVVP TVLWAFSTQR GGTDPVYNIG ALLRGCCVVA LHSLRRTAFR IKT. It is sometimes possible for the material contained within the vial of "Syntabulin (SYBU), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
