Putative histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH10 (SUVH10) Recombinant Protein | SUVH10 recombinant protein
Recombinant Arabidopsis thaliana Putative histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH10 (SUVH10)
Gene Names
SDG11; SET domain protein 11; SU(VAR)3-9 HOMOLOG 10; SUVH10; T6P5.10; T6P5_10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative histone-lysine N-methyltransferase; H3 lysine-9 specific SUVH10 (SUVH10); Recombinant Arabidopsis thaliana Putative histone-lysine N-methyltransferase; SUVH10 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-312, Full length protein
Sequence
MGLVGLHSGTIDMEFIGVEDHGDEEGKQIAVSVISSGKNADKTEDPDSLIFTGFGGTDMYHGQPCNQKLERLNIPLEAAFRKKSIVRVVRCMKDEKRTNGNIYIYDGTYMITNRWEEEGQNGFIVFKFKLVREPDQKPAFGIWKSIQNWRNGLSIRPGLILEDLSNGAENLKVCLVNEVDKENGPALFRYVTSLIHEVINNIPSMVDRCACGRRSCGSKHVFREKLSVSSSLVISAKKSGNVARFMNHSCSPNVFWQSIAREQNGLWCLYIGFFAMKHIPPLTELRYDYGKSRGGGKKMCLCRTKKCCGSFG
Sequence Length
312
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,023 Da
NCBI Official Full Name
SET domain protein 11
NCBI Official Symbol
SDG11
NCBI Official Synonym Symbols
SET domain protein 11; SU(VAR)3-9 HOMOLOG 10; SUVH10; T6P5.10; T6P5_10
NCBI Protein Information
SET domain protein 11
UniProt Protein Name
Putative inactive histone-lysine N-methyltransferase family member SUVH10
Protein Family
UniProt Gene Name
SUVH10
UniProt Synonym Gene Names
SDG11; SET11; H3-K9-HMTase 10; Su(var)3-9 homolog protein 10
NCBI Description
Predicted to encodes a SU(VAR)3-9 homolog, a SET domain protein. Known SET domain proteins are involved in epigenetic control of gene expression and act as histone methyltransferases. There are 10 SUVH genes in Arabidopsis and members of this subfamily of the SET proteins have an additional conserved SRA domain.
Uniprot Description
Histone methyltransferase family member that may lack methyltransferase activity. May methylate 'Lys-9' of histone H3. H3 'Lys-9' methylation represents a specific tag for epigenetic transcriptional repression (Potential).
Similar Products
Product Notes
The SUVH10 suvh10 (Catalog #AAA1351980) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-312, Full length protein. The amino acid sequence is listed below: MGLVGLHSGT IDMEFIGVED HGDEEGKQIA VSVISSGKNA DKTEDPDSLI FTGFGGTDMY HGQPCNQKLE RLNIPLEAAF RKKSIVRVVR CMKDEKRTNG NIYIYDGTYM ITNRWEEEGQ NGFIVFKFKL VREPDQKPAF GIWKSIQNWR NGLSIRPGLI LEDLSNGAEN LKVCLVNEVD KENGPALFRY VTSLIHEVIN NIPSMVDRCA CGRRSCGSKH VFREKLSVSS SLVISAKKSG NVARFMNHSC SPNVFWQSIA REQNGLWCLY IGFFAMKHIP PLTELRYDYG KSRGGGKKMC LCRTKKCCGS FG. It is sometimes possible for the material contained within the vial of "Putative histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH10 (SUVH10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
