Small ubiquitin-related modifier 2 (SUMO2) Recombinant Protein | SUMO2 recombinant protein

Recombinant Pig Small ubiquitin-related modifier 2 (SUMO2)

Cat. Num. AAA947917

• Gene Names: SUMO2; PSMT3; Smt3A; SMT3H2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Small ubiquitin-related modifier 2 (SUMO2); Recombinant Pig Small ubiquitin-related modifier 2 (SUMO2); SUMO2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-93, Full length protein
• Sequence: MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
• Sequence Length: 93

• Species: Sus scrofa (Pig)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for SUMO2 recombinant protein

This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

• NCBI GI #: 47522794
• NCBI GeneID: 397044
• NCBI Accession #: NP_999149.1
• NCBI GenBank Nucleotide #: NM_213984.1
• UniProt Accession #: P61958; P55855; A7WLH9
• Molecular Weight: 10,871 Da
• NCBI Official Full Name: small ubiquitin-related modifier 2
• NCBI Official Symbol: SUMO2
• NCBI Official Synonym Symbols: PSMT3; Smt3A; SMT3H2
• NCBI Protein Information: small ubiquitin-related modifier 2
• UniProt Protein Name: Small ubiquitin-related modifier 2
• Protein Family: Small ubiquitin-related modifier
• UniProt Gene Name: SUMO2
• UniProt Synonym Gene Names: SMT3A; SMT3H2; SUMO-2; Smt3A

Uniprot Description

Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. Plays a role in the regulation of sumoylation status of SETX ().