Sulfotransferase 1C2 (Sult1c2) Recombinant Protein | Sult1c2 recombinant protein
Recombinant Mouse Sulfotransferase 1C2 (Sult1c2)
Gene Names
Sult1c2; ST1C1; ST1C2; Sult1c1; 1810008N17Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sulfotransferase 1C2 (Sult1c2); Recombinant Mouse Sulfotransferase 1C2 (Sult1c2); Sult1c2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-296, full length protein
Sequence
MALTPELSRQTKLKEVAGIPLQAPTVDNWRQIQTFEAKPDDLLICTYPKSGTTWIQEIVDMIEQNGDVEKCRRTIIQHRHPFIEWARPPQPSGVDKANEMPAPRILRTHLPTQLLPPSFWTNNCKFLYVARNAKDCMVSYYHFYRMSQVLPEPGTWDEYFETFINGKVSWGSWFDHVKGWWEIRDKYQILFLFYEDMKRNPKHEIQKVMQFMGKNLDEDVVDKIVLETSFEKMKENPMTNRSTAPKSILDQSISPFMRKGTVGDWKNHFTVAQNERFDEIYKQKMGRTSLNFSMEL
Sequence Length
296
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Sult1c2 recombinant protein
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,953 Da
NCBI Official Full Name
sulfotransferase 1C2
NCBI Official Synonym Full Names
sulfotransferase family, cytosolic, 1C, member 2
NCBI Official Symbol
Sult1c2
NCBI Official Synonym Symbols
ST1C1; ST1C2; Sult1c1; 1810008N17Rik
NCBI Protein Information
sulfotransferase 1C2
UniProt Protein Name
Sulfotransferase 1C2
Protein Family
UniProt Gene Name
Sult1c2
UniProt Synonym Gene Names
Sult1c1; ST1C2
Uniprot Description
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters.
Similar Products
Product Notes
The Sult1c2 sult1c2 (Catalog #AAA1281144) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-296, full length protein. The amino acid sequence is listed below: MALTPELSRQ TKLKEVAGIP LQAPTVDNWR QIQTFEAKPD DLLICTYPKS GTTWIQEIVD MIEQNGDVEK CRRTIIQHRH PFIEWARPPQ PSGVDKANEM PAPRILRTHL PTQLLPPSFW TNNCKFLYVA RNAKDCMVSY YHFYRMSQVL PEPGTWDEYF ETFINGKVSW GSWFDHVKGW WEIRDKYQIL FLFYEDMKRN PKHEIQKVMQ FMGKNLDEDV VDKIVLETSF EKMKENPMTN RSTAPKSILD QSISPFMRKG TVGDWKNHFT VAQNERFDEI YKQKMGRTSL NFSMEL. It is sometimes possible for the material contained within the vial of "Sulfotransferase 1C2 (Sult1c2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
