Steryl-sulfatase (Sts) Recombinant Protein | Sts recombinant protein
Recombinant Mouse Steryl-sulfatase (Sts)
Gene Names
Sts; ArsC
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Steryl-sulfatase (Sts); Recombinant Mouse Steryl-sulfatase (Sts); Sts recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-624aa; Full length protein
Sequence
ADPAPAGPAPRPPNFLLIMADDLGIGDLGCYGNKTLRTPHLDRLAREGVKLTQHLAAAPL CTPSRAAFLTGRYPPRSGMAAHGRVGVYLFTASSGGLPPSEVTMARLLKGRGYATALIGK WHLGLSCRGATDFCHHPLRHGFDRFLGVPTTNLRDCRPGAGTVFGPALRVFAAGPLAALG ASLAAMAAARWAGLARVPGWALAGTAAAMLAVGGPRSASCLGFRPANCFLMDDLAVAQRP TDYGGLTRRLADEAALFLRRNRARPFLLFLSFLHVHTAHFADPGFAGRSLHGAYGDSVEE MDWGVGRVLAALDELGLARETLVYFTSDHGAHVEELGPRGERMGGSNGVFRGGKGNNWEG GVRVPCLVRWPRELSPGRVVAEPTSLMDVFPTVARLAGAELPGDRVIDGRDLMPLLRGDA QRSEHEFLFHYCNAYLQAVRWHNGSAVWKAFYFTPNFAPAGANGCFSTHVCLCAGPAHVT AHDPPLLFDLTRDPGERRPLTPEAEPRHREVLDAIDAAARAHRARLRPAPDQLAPRHLMW KPWLQLWGGGGAGGGAGAQDDSGHAHGDGSHAHDDPGHAQDRGDDDAHYGGHATTRTQAT PR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Sts recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66,591 Da
NCBI Official Full Name
steryl-sulfatase
NCBI Official Synonym Full Names
steroid sulfatase
NCBI Official Symbol
Sts
NCBI Official Synonym Symbols
ArsC
NCBI Protein Information
steryl-sulfatase
UniProt Protein Name
Steryl-sulfatase
Protein Family
UniProt Gene Name
Sts
UniProt Synonym Gene Names
ASC
UniProt Entry Name
STS_MOUSE
Uniprot Description
STS: Conversion of sulfated steroid precursors to estrogens during pregnancy. Defects in STS are the cause of ichthyosis X-linked (IXL). Ichthyosis X-linked is a keratinization disorder manifesting with mild erythroderma and generalized exfoliation of the skin within a few weeks after birth. Affected boys later develop large, polygonal, dark brown scales, especially on the neck, extremities, trunk, and buttocks. Belongs to the sulfatase family.
Protein type: Hydrolase; Membrane protein, multi-pass; Membrane protein, integral; EC 3.1.6.2; Lipid Metabolism - androgen and estrogen
Cellular Component: endoplasmic reticulum; integral to membrane; intracellular membrane-bound organelle; membrane
Molecular Function: catalytic activity; hydrolase activity; metal ion binding; steryl-sulfatase activity; sulfuric ester hydrolase activity
Biological Process: female pregnancy; lipid metabolic process; metabolic process; steroid metabolic process
Research Articles on Sts
Similar Products
Product Notes
The Sts sts (Catalog #AAA7030607) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-624aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Sts sts for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ADPAPAGPAP RPPNFLLIMA DDLGIGDLGC YGNKTLRTPH LDRLAREGVK LTQHLAAAPL CTPSRAAFLT GRYPPRSGMA AHGRVGVYLF TASSGGLPPS EVTMARLLKG RGYATALIGK WHLGLSCRGA TDFCHHPLRH GFDRFLGVPT TNLRDCRPGA GTVFGPALRV FAAGPLAALG ASLAAMAAAR WAGLARVPGW ALAGTAAAML AVGGPRSASC LGFRPANCFL MDDLAVAQRP TDYGGLTRRL ADEAALFLRR NRARPFLLFL SFLHVHTAHF ADPGFAGRSL HGAYGDSVEE MDWGVGRVLA ALDELGLARE TLVYFTSDHG AHVEELGPRG ERMGGSNGVF RGGKGNNWEG GVRVPCLVRW PRELSPGRVV AEPTSLMDVF PTVARLAGAE LPGDRVIDGR DLMPLLRGDA QRSEHEFLFH YCNAYLQAVR WHNGSAVWKA FYFTPNFAPA GANGCFSTHV CLCAGPAHVT AHDPPLLFDL TRDPGERRPL TPEAEPRHRE VLDAIDAAAR AHRARLRPAP DQLAPRHLMW KPWLQLWGGG GAGGGAGAQD DSGHAHGDGS HAHDDPGHAQ DRGDDDAHYG GHATTRTQAT PR. It is sometimes possible for the material contained within the vial of "Steryl-sulfatase (Sts), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
