Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CAAX prenyl protease 1 (STE24) Recombinant Protein | STE24 recombinant protein

Recombinant Saccharomyces cerevisiae CAAX prenyl protease 1 (STE24)

Gene Names
STE24; AFC1; PIO2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CAAX prenyl protease 1 (STE24); Recombinant Saccharomyces cerevisiae CAAX prenyl protease 1 (STE24); Recombinant CAAX prenyl protease 1 (STE24); CAAX prenyl protease 1 EC= 3.4.24.84; A-factor-converting enzyme Prenyl protein-specific endoprotease 1; PPSEP 1; STE24 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-453
Sequence
MFDLKTILDHPNIPWKLIISGFSIAQFSFESYLTYRQYQKLSETKLPPVLEDEIDDETFHKSRNYSRAKAKFSIFGDVYNLAQKLVFIKYDLFPKIWHMAVSLLNAVLPVRFHMVSTVAQSLCFLGLLSSLSTLVDLPLSYYSHFVLEEKFGFNKLTVQLWITDMIKSLTLAYAIGGPILYLFLKIFDKFPTDFLWYIMVFLFVVQILAMTIIPVFIMPMFNKFTPLEDGELKKSIESLADRVGFPLDKIFVIDGSKRSSHSNAYFTGLPFTSKRIVLFDTLVNSNSTDEITAVLAHEIGHWQKNHIVNMVIFSQLHTFLIFSLFTSIYRNTSFYNTFGFFLEKSTGSFVDPVITKEFPIIIGFMLFNDLLTPLECAMQFVMSLISRTHEYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEKKKN
Sequence Length
453
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,324 Da
NCBI Official Full Name
Ste24p
NCBI Official Symbol
STE24
NCBI Official Synonym Symbols
AFC1; PIO2
NCBI Protein Information
Ste24p
UniProt Protein Name
CAAX prenyl protease 1
Protein Family
UniProt Gene Name
STE24
UniProt Synonym Gene Names
AFC1; PPSEP 1
UniProt Entry Name
STE24_YEAST

Uniprot Description

Function: Proteolytically removes the C-terminal three residues of farnesylated A-factor mating pheromone. Also acts to cleave the N-terminal extension of the pheromone. Does not act on Ras. Ref.1 Ref.4 Ref.5 Ref.6 Ref.7

Catalytic activity: The peptide bond hydrolyzed can be designated -C-|-A-A-X in which C is an S-isoprenylated cysteine residue, A is usually aliphatic and X is the C-terminal residue of the substrate protein, and may be any of several amino acids.

Cofactor: Binds 1 zinc ion per subunit

By similarity.

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein Ref.9.

Miscellaneous: Present with 19600 molecules/cell in log phase SD medium.

Sequence similarities: Belongs to the peptidase M48A family.

Similar Products

Product Notes

The STE24 ste24 (Catalog #AAA1051302) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-453. The amino acid sequence is listed below: MFDLKTILDH PNIPWKLIIS GFSIAQFSFE SYLTYRQYQK LSETKLPPVL EDEIDDETFH KSRNYSRAKA KFSIFGDVYN LAQKLVFIKY DLFPKIWHMA VSLLNAVLPV RFHMVSTVAQ SLCFLGLLSS LSTLVDLPLS YYSHFVLEEK FGFNKLTVQL WITDMIKSLT LAYAIGGPIL YLFLKIFDKF PTDFLWYIMV FLFVVQILAM TIIPVFIMPM FNKFTPLEDG ELKKSIESLA DRVGFPLDKI FVIDGSKRSS HSNAYFTGLP FTSKRIVLFD TLVNSNSTDE ITAVLAHEIG HWQKNHIVNM VIFSQLHTFL IFSLFTSIYR NTSFYNTFGF FLEKSTGSFV DPVITKEFPI IIGFMLFNDL LTPLECAMQF VMSLISRTHE YQADAYAKKL GYKQNLCRAL IDLQIKNLST MNVDPLYSSY HYSHPTLAER LTALDYVSEK KKN. It is sometimes possible for the material contained within the vial of "CAAX prenyl protease 1 (STE24), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.