SH3 and cysteine-rich domain-containing protein 2 (STAC2) Recombinant Protein | STAC2 recombinant protein
Recombinant Human SH3 and cysteine-rich domain-containing protein 2 (STAC2)
Gene Names
STAC2; 24b2; 24b2/STAC2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
SH3 and cysteine-rich domain-containing protein 2 (STAC2); Recombinant Human SH3 and cysteine-rich domain-containing protein 2 (STAC2); STAC2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-411, Full length protein
Sequence
MTEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLENFFLRSGSELKCPTEVLLTPPTPLPPPSPPPTASDRGLATPSPSPCPVPRPLAALKPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKMCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHEPPPVCATSKESPPTGDSGKVDPVYETLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFSGNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPVDALTEI
Sequence Length
411
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,484 Da
NCBI Official Full Name
SH3 and cysteine-rich domain-containing protein 2 isoform 1
NCBI Official Synonym Full Names
SH3 and cysteine rich domain 2
NCBI Official Symbol
STAC2
NCBI Official Synonym Symbols
24b2; 24b2/STAC2
NCBI Protein Information
SH3 and cysteine-rich domain-containing protein 2
UniProt Protein Name
SH3 and cysteine-rich domain-containing protein 2
Protein Family
UniProt Gene Name
STAC2
NCBI Description
This gene encodes a protein containing an SH3 domain and a zinc finger domain. The encoded protein has been shown to regulate calcium channel inactivation in a human cell line. Reduced expression of this gene has been observed in human heart failure. [provided by RefSeq, May 2017]
Uniprot Description
Slows down the inactivation rate of the calcium channel CACNA1C.
Similar Products
Product Notes
The STAC2 stac2 (Catalog #AAA1471005) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-411, Full length protein. The amino acid sequence is listed below: MTEMSEKENE PDDAATHSPP GTVSALQETK LQRFKRSLSL KTILRSKSLE NFFLRSGSEL KCPTEVLLTP PTPLPPPSPP PTASDRGLAT PSPSPCPVPR PLAALKPVRL HSFQEHVFKR ASPCELCHQL IVGNSKQGLR CKMCKVSVHL WCSEEISHQQ CPGKTSTSFR RNFSSPLLVH EPPPVCATSK ESPPTGDSGK VDPVYETLRY GTSLALMNRS SFSSTSESPT RSLSERDELT EDGEGSIRSS EEGPGDSASP VFTAPAESEG PGPEEKSPGQ QLPKATLRKD VGPMYSYVAL YKFLPQENND LALQPGDRIM LVDDSNEDWW KGKIGDRVGF FPANFVQRVR PGENVWRCCQ PFSGNKEQGY MSLKENQICV GVGRSKDADG FIRVSSGKKR GLVPVDALTE I. It is sometimes possible for the material contained within the vial of "SH3 and cysteine-rich domain-containing protein 2 (STAC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
