Suppression Of Tumorigenicity 14 (ST14) Recombinant Protein | ST14 recombinant protein
Recombinant Suppression Of Tumorigenicity 14 (ST14)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-RSFTRQARVV GGTDADEGEW PWQVSLHALG QGHICGASLI SPNWLVSAAH CYIDDRGFRY SDPTQWTAFL GLHDQSQRSA PGVQERRLKR IISHPFFNDF TFDYDIALLE LEKPAEYSSM VRPICLPDAS HVFPAGKAIW VTGWGHTQYG GTGALILQKG EIRVINQTTC ENLLPQQITP RMMCVGFLSG GVDSCQGDSG GPLSSVEADG RIFQAGVVSW GDGCAQRNKP GVYTRLPLFR DWIKEN
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.
NCBI and Uniprot Product Information
NCBI Description
The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis. [provided by RefSeq, Jul 2008]
Uniprot Description
ST14: Degrades extracellular matrix. Proposed to play a role in breast cancer invasion and metastasis. Exhibits trypsin-like activity as defined by cleavage of synthetic substrates with Arg or Lys as the P1 site. Defects in ST14 are a cause of ichthyosis autosomal recessive with hypotrichosis (ARIH). ARIH is a skin disorder characterized by congenital ichthyosis associated with the presence of less than the normal amount of hair. Belongs to the peptidase S1 family.
Protein type: EC 3.4.21.109; Membrane protein, integral; Protease
Chromosomal Location of Human Ortholog: 11q24-q25
Cellular Component: extrinsic to plasma membrane; extracellular space; basolateral plasma membrane; integral to plasma membrane; plasma membrane
Molecular Function: serine-type peptidase activity; serine-type endopeptidase activity
Biological Process: keratinocyte differentiation; proteolysis
Disease: Ichthyosis, Congenital, Autosomal Recessive 11
Research Articles on ST14
Similar Products
Product Notes
The ST14 st14 (Catalog #AAA2011583) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Suppression Of Tumorigenicity 14 (ST14) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the ST14 st14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-RSFTRQA RVV GGTDADEGEW PWQVSLHALG QGHICGASLI SPNWLVSAAH CYIDDRGFRY SDPTQWTAFL GLHDQSQRSA PGVQERRLKR IISHPFFNDF TFDYDIALLE LEKPAEYSSM VRPICLPDAS HVFPAGKAIW VTGWGHTQYG GTGALILQKG EIRVINQTTC ENLLPQQITP RMMCVGFLSG GVDSCQGDSG GPLSSVEADG RIFQAGVVSW GDGCAQRNKP GVYTRLPLFR DWIKEN. It is sometimes possible for the material contained within the vial of "Suppression Of Tumorigenicity 14 (ST14), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.