Somatostatin receptor type 2 (SSTR2) Recombinant Protein | SSTR2 recombinant protein
Recombinant Bovine Somatostatin receptor type 2 (SSTR2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Somatostatin receptor type 2 (SSTR2); Recombinant Bovine Somatostatin receptor type 2 (SSTR2); SSTR2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-368. Full length.
Sequence
MDLVSELNETQPWLTTPFDLNGSVGAANISNQTEPYYDLASNVVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Sequence Length
368
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Bovine
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SSTR2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,134 Da
NCBI Official Full Name
somatostatin receptor type 2
NCBI Official Symbol
SSTR2
NCBI Protein Information
somatostatin receptor type 2
UniProt Protein Name
Somatostatin receptor type 2
Protein Family
UniProt Gene Name
SSTR2
UniProt Synonym Gene Names
SS-2-R; SS2-R; SS2R
UniProt Entry Name
SSR2_BOVIN
Uniprot Description
Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization ().
Research Articles on SSTR2
Similar Products
Product Notes
The SSTR2 sstr2 (Catalog #AAA7030529) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-368. Full length. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SSTR2 sstr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDLVSELNET QPWLTTPFDL NGSVGAANIS NQTEPYYDLA SNVVLTFIYF VVCIIGLCGN TLVIYVILRY AKMKTITNIY ILNLAIADEL FMLGLPFLAM QVALVHWPFG KAICRVVMTV DGINQFTSIF CLTVMSIDRY LAVVHPIKSA KWRRPRTAKM INVAVWGVSL LVILPIMIYA GLRSNQWGRS SCTINWPGES GAWYTGFIIY AFILGFLVPL TIICLCYLFI IIKVKSSGIR VGSSKRKKSE KKVTRMVSIV VAVFIFCWLP FYIFNVSSVS VAISPTPALK GMFDFVVVLT YANSCANPIL YAFLSDNFKK SFQNVLCLVK VSGTDDGERS DSKQDKSRLN ETTETQRTLL NGDLQTSI . It is sometimes possible for the material contained within the vial of "Somatostatin receptor type 2 (SSTR2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
