Translocon-associated protein subunit beta (SSR2) Recombinant Protein | SSR2 recombinant protein
Recombinant Dog Translocon-associated protein subunit beta (SSR2)
Gene Names
SSR2; gp25H
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Translocon-associated protein subunit beta (SSR2); Recombinant Dog Translocon-associated protein subunit beta (SSR2); Recombinant Translocon-associated protein subunit beta (SSR2); Translocon-associated protein subunit beta; TRAP-beta; Glycoprotein 25H; gp25H Signal sequence receptor subunit beta; SSR-beta; SSR2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-183
Sequence
EEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATVTYLAQEDGPVVIGFTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKSKKN
Sequence Length
183
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,100 Da
NCBI Official Full Name
translocon-associated protein subunit beta
NCBI Official Symbol
SSR2
NCBI Official Synonym Symbols
gp25H
NCBI Protein Information
translocon-associated protein subunit beta; SSR-beta; TRAP-beta; glycoprotein 25H; signal sequence receptor beta subunit; signal sequence receptor subunit beta
UniProt Protein Name
Translocon-associated protein subunit beta
Protein Family
UniProt Gene Name
SSR2
UniProt Synonym Gene Names
TRAP-beta; gp25H; SSR-beta
UniProt Entry Name
SSRB_CANFA
Uniprot Description
Function: TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins.
Subunit structure: Heterotetramer of TRAP-alpha, TRAP-beta, TRAP-delta and TRAP-gamma. Interacts with TMEM173/STING
By similarity.
Subcellular location: Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Sequence similarities: Belongs to the TRAP-beta family.
Similar Products
Product Notes
The SSR2 ssr2 (Catalog #AAA953205) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-183. The amino acid sequence is listed below: EEGARLLASK SLLNRYAVEG RDLTLQYNIY NVGSSAALDV ELSDDSFPPE DFGIVSGMLN VKWDRIAPAS NVSHTVVLRP LKAGYFNFTS ATVTYLAQED GPVVIGFTSA PGQGGILAQR EFDRRFSPHF LDWAAFGVMT LPSIGIPLLL WYSSKRKYDT PKSKKN. It is sometimes possible for the material contained within the vial of "Translocon-associated protein subunit beta (SSR2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
