Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Calcium-responsive transcription coactivator (Ss18l1) Recombinant Protein | Ss18l1 recombinant protein

Recombinant Rat Calcium-responsive transcription coactivator (Ss18l1)

Gene Names
Ss18l1; CREST
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium-responsive transcription coactivator (Ss18l1); Recombinant Rat Calcium-responsive transcription coactivator (Ss18l1); Ss18l1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-401, full length protein
Sequence
MSVAFASARPRGKGEVTQQTIQKMLDENHHLIQCILDYQSKGKTAECTQYQQILHRNLVYLATIADSNQNMQSLLPAPPTQNMNLGPGALSQSGSSQGLHPQGSLSDTVSTGLPPASLMQGQIGNGPNHVSMQQTAQSTLPTTSMSMSGSGHGTGPGYSHSGPTSQSVPMQGQGAISNYVSRTNINMQSNPVSMMHQQAARPTTTQRRVEASITRARRPLHDGPGWQGGSMMGQRPMAPYRPSQQGSSQQYLGQEEYYSEQYSHSQGSAEPMSQQYYPDGHSDYAYQQSSYTEQSYDRSFEDPTQHYYEGGNSQYSQQQAGYQQGTAQQQTYSQQQYPNQQSYPGQQQGYGPAQGAPSQYSGYQQGQGQQYGSYRTSQTGPSAQQQRPYGYEQGQYGNYQQ
Sequence Length
401
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,999 Da
NCBI Official Full Name
calcium-responsive transcription coactivator
NCBI Official Synonym Full Names
SS18L1, nBAF chromatin remodeling complex subunit
NCBI Official Symbol
Ss18l1
NCBI Official Synonym Symbols
CREST
NCBI Protein Information
calcium-responsive transcription coactivator
UniProt Protein Name
Calcium-responsive transcription coactivator
UniProt Gene Name
Ss18l1
UniProt Synonym Gene Names
Crest

NCBI Description

acts as a transcriptional coactivator; regulated by calcium [RGD, Feb 2006]

Uniprot Description

Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP.

Research Articles on Ss18l1

Similar Products

Product Notes

The Ss18l1 ss18l1 (Catalog #AAA1287482) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-401, full length protein. The amino acid sequence is listed below: MSVAFASARP RGKGEVTQQT IQKMLDENHH LIQCILDYQS KGKTAECTQY QQILHRNLVY LATIADSNQN MQSLLPAPPT QNMNLGPGAL SQSGSSQGLH PQGSLSDTVS TGLPPASLMQ GQIGNGPNHV SMQQTAQSTL PTTSMSMSGS GHGTGPGYSH SGPTSQSVPM QGQGAISNYV SRTNINMQSN PVSMMHQQAA RPTTTQRRVE ASITRARRPL HDGPGWQGGS MMGQRPMAPY RPSQQGSSQQ YLGQEEYYSE QYSHSQGSAE PMSQQYYPDG HSDYAYQQSS YTEQSYDRSF EDPTQHYYEG GNSQYSQQQA GYQQGTAQQQ TYSQQQYPNQ QSYPGQQQGY GPAQGAPSQY SGYQQGQGQQ YGSYRTSQTG PSAQQQRPYG YEQGQYGNYQ Q. It is sometimes possible for the material contained within the vial of "Calcium-responsive transcription coactivator (Ss18l1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.