Serine/arginine-rich splicing factor 1 (SRSF1) Recombinant Protein | SRSF1 recombinant protein
Recombinant Bovine Serine/arginine-rich splicing factor 1 (SRSF1)
Gene Names
SRSF1; SFRS1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/arginine-rich splicing factor 1 (SRSF1); Recombinant Bovine Serine/arginine-rich splicing factor 1 (SRSF1); SRSF1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-248, full length protein
Sequence
SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT
Sequence Length
247
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,745 Da
NCBI Official Full Name
serine/arginine-rich splicing factor 1
NCBI Official Synonym Full Names
serine and arginine rich splicing factor 1
NCBI Official Symbol
SRSF1
NCBI Official Synonym Symbols
SFRS1
NCBI Protein Information
serine/arginine-rich splicing factor 1
UniProt Protein Name
Serine/arginine-rich splicing factor 1
Protein Family
UniProt Gene Name
SRSF1
UniProt Synonym Gene Names
SFRS1
Uniprot Description
Plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. Interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice site-containing pre-mRNA. Binds to purine-rich RNA sequences, either the octamer, 5'-RGAAGAAC-3' (r=A or G) or the decamers, AGGACAGAGC/AGGACGAAGC. Binds preferentially to the 5'-CGAGGCG-3' motif in vitro. Three copies of the octamer constitute a powerful splicing enhancer in vitro, the ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing. May function as export adapter involved in mRNA nuclear export through the TAP/NXF1 pathway ().
Similar Products
Product Notes
The SRSF1 srsf1 (Catalog #AAA1348430) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-248, full length protein. The amino acid sequence is listed below: SGGGVIRGPA GNNDCRIYVG NLPPDIRTKD IEDVFYKYGA IRDIDLKNRR GGPPFAFVEF EDPRDAEDAV YGRDGYDYDG YRLRVEFPRS GRGTGRGGGG GGGGGAPRGR YGPPSRRSEN RVVVSGLPPS GSWQDLKDHM REAGDVCYAD VYRDGTGVVE FVRKEDMTYA VRKLDNTKFR SHEGETAYIR VKVDGPRSPS YGRSRSRSRS RSRSRSRSNS RSRSYSPRRS RGSPRYSPRH SRSRSRT. It is sometimes possible for the material contained within the vial of "Serine/arginine-rich splicing factor 1 (SRSF1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
