Probable inactive poly [ADP-ribose] polymerase SRO5 (SRO5) Recombinant Protein | SRO5 recombinant protein
Recombinant Arabidopsis thaliana Probable inactive poly [ADP-ribose] polymerase SRO5 (SRO5)
Gene Names
SRO5; K19B1.13; K19B1_13; similar to RCD one 5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable inactive poly [ADP-ribose] polymerase SRO5 (SRO5); Recombinant Arabidopsis thaliana Probable inactive poly [ADP-ribose] polymerase SRO5 (SRO5); SRO5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-309, Full length protein
Sequence
MDYVRTQVEAVFDDSEQDGSTISESGSCDSSSDRSFADELGLMELLEGDKAHDLIYRNCKSGLGDQCQILSVLRNGFRNVGSRAKLKTFQVFQEAVQMKHGGDGGAKVKYGWCSVSKHELKTIFEYGFSEPLRNDGSFGRGLYLSPDNSPLDCLKDSASESEDGMRFLLLCRVLLGKSEIVPQGSTRSCPSSPEFDSGVDDLVSTKKYIVWSTHMNTHVLPEFLVCIKAPFNLTRSPKRLRSPWMAFPVLIKALSKFLPPSQILVIQKHYKDQQNRRITRSELIQRVRSITGDKLLVHIIKACGHKVQH
Sequence Length
309
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,717 Da
NCBI Official Full Name
similar to RCD one 5
NCBI Official Symbol
SRO5
NCBI Official Synonym Symbols
K19B1.13; K19B1_13; similar to RCD one 5
NCBI Protein Information
similar to RCD one 5
UniProt Protein Name
Probable inactive poly [ADP-ribose] polymerase SRO5
Protein Family
UniProt Gene Name
SRO5
NCBI Description
Encodes a protein with similarity to RCD1 but without the WWE domain. The protein does have a PARP signature upstream of the C-terminal protein interaction domain. The PARP signature may bind NAD+ and attach the ADP-ribose-moiety from NAD+ to the target molecule. Its presence suggests a role for the protein in ADP ribosylation. Up-regulated by NaCl. SRO5 and P5CDH (an overlapping gene in the antisense orientation) generate 24-nt and 21-nt siRNAs, which together are components of a regulatory loop controlling reactive oxygen species (ROS) production and stress response.
Uniprot Description
Probable inactive ADP-ribosyltransferase that may be involved in stress and developmental responses.
Research Articles on SRO5
Similar Products
Product Notes
The SRO5 sro5 (Catalog #AAA1413900) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-309, Full length protein. The amino acid sequence is listed below: MDYVRTQVEA VFDDSEQDGS TISESGSCDS SSDRSFADEL GLMELLEGDK AHDLIYRNCK SGLGDQCQIL SVLRNGFRNV GSRAKLKTFQ VFQEAVQMKH GGDGGAKVKY GWCSVSKHEL KTIFEYGFSE PLRNDGSFGR GLYLSPDNSP LDCLKDSASE SEDGMRFLLL CRVLLGKSEI VPQGSTRSCP SSPEFDSGVD DLVSTKKYIV WSTHMNTHVL PEFLVCIKAP FNLTRSPKRL RSPWMAFPVL IKALSKFLPP SQILVIQKHY KDQQNRRITR SELIQRVRSI TGDKLLVHII KACGHKVQH. It is sometimes possible for the material contained within the vial of "Probable inactive poly [ADP-ribose] polymerase SRO5 (SRO5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
