Protein rdoA (rdoA) Recombinant Protein | rdoA recombinant protein

Recombinant Escherichia coli Protein rdoA (rdoA)

Cat. Num. AAA1120842

• Gene Names: srkA; ECK3851; JW3831; orfA; rdoA; yihE
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein rdoA (rdoA); Recombinant Escherichia coli Protein rdoA (rdoA); rdoA recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-328, full length protein
• Sequence: MNNSAFTFQTLHPDTIMDALFEHGIRVDSGLTPLNSYENRVYQFQDEDRRRFVVKFYRPERWTADQILEEHQFALQLVNDEVPVAAPVAFNGQTLLNHQGFYFAVFPSVGGRQFEADNIDQMEAVGRYLGRMHQTGRKQLFIHRPTIGLNEYLIEPRKLFEDATLIPSGLKAAFLKATDELIAAVTAHWREDFTVLRLHGDCHAGNILWRDGPMFVDLDDARNGPAVQDLWMLLNGDKAEQRMQLETIIEAYEEFSEFDTAEIGLIEPLRAMRLVYYLAWLMRRWADPAFPKNFPWLTGEDYWLRQTATFIEQAKVLQEPPLQLTPMY
• Sequence Length: 328

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16131700
• NCBI GeneID: 948346
• NCBI Accession #: NP_418296.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0C0K3; P32127; Q2M8F7
• Molecular Weight: 38,120 Da
• NCBI Official Full Name: Cpx stress response Thr/Ser protein kinase; MazF antagonist protein
• NCBI Official Symbol: srkA
• NCBI Official Synonym Symbols: ECK3851; JW3831; orfA; rdoA; yihE
• NCBI Protein Information: Cpx stress response Thr/Ser protein kinase; MazF antagonist protein
• UniProt Protein Name: Stress response kinase A
• Protein Family: Serine/threonine protein kinase
• UniProt Gene Name: srkA

NCBI Description

rdoA is required for long-term cell survival and for the expression of surface appendages (Zheng, 2007). [More information is available at EcoGene: EG11831]. YihE is a serine/threonine protein kinase that is able to autophosphorylate at serine and threonine, but not tyrosine residues. [More information is available at EcoCyc: EG11831].

Uniprot Description

A protein kinase that (auto)phosphorylates on Ser and Thr residues (PubMed:17302814). Probably acts to suppress the effects of stress linked to accumulation of reactive oxygen species. Protects cells from stress by antagonizing the MazE-MazF TA module, probably indirectly as it has not been seen to phosphorylate MazE, MazF or MazG (PubMed:23416055). Probably involved in the extracytoplasmic stress response (PubMed:9159398).