Serine/threonine-protein kinase srb10 (srb10) Recombinant Protein | srb10 recombinant protein
Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase srb10 (srb10)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/threonine-protein kinase srb10 (srb10); Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase srb10 (srb10); srb10 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-369, Full length
Sequence
MKDGYKIIGFISSGTYGKVYKAVSSNSNDKRLFAIKKFKAESKQVSSNAQQTGVSQSAIREMMLCREIQHENIVSLVQVLLKDGTISMVFEYAEHDLLQIIHFHSRSRTRQIPPSILKSILWQIINGVAYLHENWIMHRDLKPANIMITATGKVKIGDLGLGRLIRDPILPFYSSDRVVVTIWYRAPELLLGAHDYTPAIDVWAIGCIYGEMLALSPLFKGDEIKMEDKKVVPFQSTQMLRIMELLGTPTEERWPGLKNYPEYYQLSSFEVRYWNNLLPQWYQTVKNRDPQGLDLLMKMLQYDPKSRITAKQALEHVFFTSDKLWTTSPFLNQPIHYPERRISEDDSEVSSKRVLSTSLRSESKRFKGN
Sequence Length
369
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,585 Da
NCBI Official Full Name
cyclin-dependent protein Srb mediator subunit kinase Srb10
NCBI Official Symbol
srb10
NCBI Protein Information
cyclin-dependent protein Srb mediator subunit kinase Srb10
UniProt Protein Name
Serine/threonine-protein kinase srb10
Protein Family
UniProt Gene Name
srb10
UniProt Synonym Gene Names
cdk8; prk1
Uniprot Description
Catalytic component of the Cdk8 module/Srb8-11 module which is a regulatory module of the Mediator complex that regulates basal RNA polymerase II transcription. The Cdk8 module may sterically hinder the interaction between Mediator and RNA polymerase II leading to transcriptional repression of a subset of genes regulated by Mediator.
Research Articles on srb10
Similar Products
Product Notes
The srb10 srb10 (Catalog #AAA1195290) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-369, Full length. The amino acid sequence is listed below: MKDGYKIIGF ISSGTYGKVY KAVSSNSNDK RLFAIKKFKA ESKQVSSNAQ QTGVSQSAIR EMMLCREIQH ENIVSLVQVL LKDGTISMVF EYAEHDLLQI IHFHSRSRTR QIPPSILKSI LWQIINGVAY LHENWIMHRD LKPANIMITA TGKVKIGDLG LGRLIRDPIL PFYSSDRVVV TIWYRAPELL LGAHDYTPAI DVWAIGCIYG EMLALSPLFK GDEIKMEDKK VVPFQSTQML RIMELLGTPT EERWPGLKNY PEYYQLSSFE VRYWNNLLPQ WYQTVKNRDP QGLDLLMKML QYDPKSRITA KQALEHVFFT SDKLWTTSPF LNQPIHYPER RISEDDSEVS SKRVLSTSLR SESKRFKGN. It is sometimes possible for the material contained within the vial of "Serine/threonine-protein kinase srb10 (srb10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
