Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Squalene monooxygenase (Sqle) Recombinant Protein | Sqle recombinant protein

Recombinant Rat Squalene monooxygenase (Sqle)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Squalene monooxygenase (Sqle); Recombinant Rat Squalene monooxygenase (Sqle); Recombinant Squalene monooxygenase (Sqle); Squalene monooxygenase EC= 1.14.13.132; Squalene epoxidase; SE; Sqle recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-573
Sequence
MWTFLGIATFTYFYKKCGDVTLANKELLLCVLVFLSLGLVLSYRCRHRNGGLLGRHQSGSQFAAFSDILSALPLIGFFWAKSPPESEKKEQLESKRRRKEVNLSETTLTGAATSVSTSSVTDPEVIIIGSGVLGSALATVLSRDGRTVTVIERDLKEPDRILGECLQPGGYRVLRELGLGDTVESLNAHHIHGYVIHDCESRSEVQIPYPVSENNQVQSGVAFHHGKFIMSLRKAAMAEPNVKFIEGVVLRLLEEDDAVIGVQYKDKETGDTKELHAPLTVVADGLFSKFRKNLISNKVSVSSHFVGFIMKDAPQFKANFAELVLVDPSPVLIYQISPSETRVLVDIRGELPRNLREYMTEQIYPQIPDHLKESFLEACQNARLRTMPASFLPPSSVNKRGVLLLGDAYNLRHPLTGGGMTVALKDIKIWRQLLKDIPDLYDDAAIFQAKKSFFWSRKRSHSFVVNVLAQALYELFSATDDSLRQLRKACFLYFKLGGECLTGPVGLLSILSPDPLLLIRHFFSVAVYATYFCFKSEPWATKPRALFSSGAILYKACSIIFPLIYSEMKYLVH
Sequence Length
573
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,024 Da
NCBI Official Full Name
squalene monooxygenase
NCBI Official Synonym Full Names
squalene epoxidase
NCBI Official Symbol
Sqle
NCBI Protein Information
squalene monooxygenase; SE
UniProt Protein Name
Squalene monooxygenase
Protein Family
UniProt Gene Name
Sqle
UniProt Synonym Gene Names
Erg1; SE
UniProt Entry Name
ERG1_RAT

NCBI Description

enzyme that catalyzes sterol biosyntesis; may be the rare-limiting step in sterol biosynthesis pathway [RGD, Feb 2006]

Uniprot Description

Function: Catalyzes the first oxygenation step in sterol biosynthesis and is suggested to be one of the rate-limiting enzymes in this pathway.

Catalytic activity: Squalene + NADPH + O2 = (3S)-2,3-epoxy-2,3-dihydrosqualene + NADP+ + H2O.

Cofactor: FAD.

Pathway: Terpene metabolism; lanosterol biosynthesis; lanosterol from farnesyl diphosphate: step 2/3.

Subunit structure: May form a complex with squalene synthase.

Subcellular location: Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Sequence similarities: Belongs to the squalene monooxygenase family.

Research Articles on Sqle

Similar Products

Product Notes

The Sqle sqle (Catalog #AAA959433) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-573. The amino acid sequence is listed below: MWTFLGIATF TYFYKKCGDV TLANKELLLC VLVFLSLGLV LSYRCRHRNG GLLGRHQSGS QFAAFSDILS ALPLIGFFWA KSPPESEKKE QLESKRRRKE VNLSETTLTG AATSVSTSSV TDPEVIIIGS GVLGSALATV LSRDGRTVTV IERDLKEPDR ILGECLQPGG YRVLRELGLG DTVESLNAHH IHGYVIHDCE SRSEVQIPYP VSENNQVQSG VAFHHGKFIM SLRKAAMAEP NVKFIEGVVL RLLEEDDAVI GVQYKDKETG DTKELHAPLT VVADGLFSKF RKNLISNKVS VSSHFVGFIM KDAPQFKANF AELVLVDPSP VLIYQISPSE TRVLVDIRGE LPRNLREYMT EQIYPQIPDH LKESFLEACQ NARLRTMPAS FLPPSSVNKR GVLLLGDAYN LRHPLTGGGM TVALKDIKIW RQLLKDIPDL YDDAAIFQAK KSFFWSRKRS HSFVVNVLAQ ALYELFSATD DSLRQLRKAC FLYFKLGGEC LTGPVGLLSI LSPDPLLLIR HFFSVAVYAT YFCFKSEPWA TKPRALFSSG AILYKACSII FPLIYSEMKY LVH. It is sometimes possible for the material contained within the vial of "Squalene monooxygenase (Sqle), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.