Squalene monooxygenase (SQLE) Recombinant Protein | SQLE recombinant protein
Recombinant Human Squalene monooxygenase (SQLE)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Squalene monooxygenase (SQLE); Recombinant Human Squalene monooxygenase (SQLE); SQLE recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-574aa; full length protein
Sequence
MWTFLGIATFTYFYKKFGDFITLANREVLLCVLVFLSLGLVLSYRCRHRNGGLLGRQQSG SQFALFSDILSGLPFIGFFWAKSPPESENKEQLEARRRRKGTNISETSLIGTAACTSTSS QNDPEVIIVGAGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGL GDTVEGLDAQVVNGYMIHDQESKSEVQIPYPLSENNQVQSGRAFHHGRFIMSLRKAAMAE PNAKFIEGVVLQLLEEDDVVMGVQYKDKETGDIKELHAPLTVVADGLFSKFRKSLVSNKV SVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRGEMPRNLREYM VEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKKRGVLLLGDAYNMRHPLTGGG MTVAFKDIKLWRKLLKGIPDLYDDAAIFEAKKSFYWARKTSHSFVVNILAQALYELFSAT DDSLHQLRKACFLYFKLGGECVAGPVGLLSVLSPNPLVLIGHFFAVAIYAVYFCFKSEPW ITKPRALLSSGAVLYKACSVIFPLIYSEMKYMVH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SQLE recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
63,923 Da
NCBI Official Full Name
squalene monooxygenase
NCBI Official Synonym Full Names
squalene epoxidase
NCBI Official Symbol
SQLE
NCBI Protein Information
squalene monooxygenase
UniProt Protein Name
Squalene monooxygenase
Protein Family
UniProt Gene Name
SQLE
UniProt Synonym Gene Names
ERG1; SE
UniProt Entry Name
ERG1_HUMAN
NCBI Description
Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway. [provided by RefSeq, Jul 2008]
Uniprot Description
SQLE: Catalyzes the first oxygenation step in sterol biosynthesis and is suggested to be one of the rate-limiting enzymes in this pathway. Belongs to the squalene monooxygenase family.
Protein type: Membrane protein, multi-pass; EC 1.14.13.132; Lipid Metabolism - steroid biosynthesis; Membrane protein, integral; Oxidoreductase; Endoplasmic reticulum
Chromosomal Location of Human Ortholog: 8q24.1
Cellular Component: endoplasmic reticulum membrane; integral to membrane
Molecular Function: FAD binding; squalene monooxygenase activity
Biological Process: aromatic compound metabolic process; cholesterol biosynthetic process; response to organic substance; sterol biosynthetic process
Research Articles on SQLE
Similar Products
Product Notes
The SQLE sqle (Catalog #AAA7030346) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-574aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SQLE sqle for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MWTFLGIATF TYFYKKFGDF ITLANREVLL CVLVFLSLGL VLSYRCRHRN GGLLGRQQSG SQFALFSDIL SGLPFIGFFW AKSPPESENK EQLEARRRRK GTNISETSLI GTAACTSTSS QNDPEVIIVG AGVLGSALAA VLSRDGRKVT VIERDLKEPD RIVGEFLQPG GYHVLKDLGL GDTVEGLDAQ VVNGYMIHDQ ESKSEVQIPY PLSENNQVQS GRAFHHGRFI MSLRKAAMAE PNAKFIEGVV LQLLEEDDVV MGVQYKDKET GDIKELHAPL TVVADGLFSK FRKSLVSNKV SVSSHFVGFL MKNAPQFKAN HAELILANPS PVLIYQISSS ETRVLVDIRG EMPRNLREYM VEKIYPQIPD HLKEPFLEAT DNSHLRSMPA SFLPPSSVKK RGVLLLGDAY NMRHPLTGGG MTVAFKDIKL WRKLLKGIPD LYDDAAIFEA KKSFYWARKT SHSFVVNILA QALYELFSAT DDSLHQLRKA CFLYFKLGGE CVAGPVGLLS VLSPNPLVLI GHFFAVAIYA VYFCFKSEPW ITKPRALLSS GAVLYKACSV IFPLIYSEMK YMVH. It is sometimes possible for the material contained within the vial of "Squalene monooxygenase (SQLE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
