SDS-PAGE
Small proline-rich protein 2A Recombinant Protein | Sprr2a recombinant protein
Recombinant Mouse Small proline-rich protein 2A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Small proline-rich protein 2A; Recombinant Mouse Small proline-rich protein 2A; Mus musculus (Mouse); Sprr2a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-83aa; Full Length
Sequence
MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK
Sequence Length
83
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Sprr2a recombinant protein
Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane
Product Categories/Family for Sprr2a recombinant protein
References
"Mouse Sprr2 genes: a clustered family of genes showing differential expression in epithelial tissues."
Song H.J., Poy G., Darwiche N., Lichti U., Kuroki T., Steinert P.M., Kartasova T.
Genomics 55:28-42(1999)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13.4 kDa
NCBI Official Full Name
small proline-rich protein 2A2
NCBI Official Synonym Full Names
small proline-rich protein 2A2
NCBI Official Symbol
Sprr2a2
NCBI Protein Information
small proline-rich protein 2A2
UniProt Protein Name
Small proline-rich protein 2A
Protein Family
UniProt Gene Name
Sprr2a
UniProt Entry Name
SPR2A_MOUSE
Uniprot Description
SPRR2A: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. Belongs to the cornifin (SPRR) family. During squamous differentiation of epidermal keratinocytes
Similar Products
Product Notes
The Sprr2a sprr2a (Catalog #AAA1345074) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-83aa; Full Length. The amino acid sequence is listed below: MSYYQQQCNQ PCRPPPVCPP PKCPEPCPPQ VWPGPCRPVM CFEPCLPSVW PGPCRPVVCY EQCPPQPWQS TCPPVQFPPC QQK. It is sometimes possible for the material contained within the vial of "Small proline-rich protein 2A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
