Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) Recombinant Protein | SPRED1 recombinant protein

Recombinant Human Sprouty-related, EVH1 domain-containing protein 1 (SPRED1)

Cat. Num. AAA1321540

• Gene Names: SPRED1; NFLS; hSpred1; spred-1; PPP1R147
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Sprouty-related; EVH1 domain-containing protein 1 (SPRED1); Recombinant Human Sprouty-related; EVH1 domain-containing protein 1; Spred-1; hSpred1; SPRED1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-444. Full Length of Mature Protein
• Sequence: SEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDETKLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for SPRED1 recombinant protein

Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow

Product Categories/Family for SPRED1 recombinant protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 22749221
• NCBI GeneID: 161742
• NCBI Accession #: NP_689807.1
• NCBI GenBank Nucleotide #: NM_152594.2
• UniProt Accession #: Q7Z699; Q05D53; Q8N256; B2RPJ8
• Molecular Weight: 70.3 kDa
• NCBI Official Full Name: sprouty-related, EVH1 domain-containing protein 1
• NCBI Official Synonym Full Names: sprouty-related, EVH1 domain containing 1
• NCBI Official Symbol: SPRED1
• NCBI Official Synonym Symbols: NFLS; hSpred1; spred-1; PPP1R147
• NCBI Protein Information: sprouty-related, EVH1 domain-containing protein 1; suppressor of Ras/MAPK activation; protein phosphatase 1, regulatory subunit 147
• UniProt Protein Name: Sprouty-related, EVH1 domain-containing protein 1
• Protein Family: Sprouty-related, EVH1 domain-containing protein
• UniProt Gene Name: SPRED1
• UniProt Synonym Gene Names: Spred-1; hSpred1
• UniProt Entry Name: SPRE1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Sprouty family of proteins and is phosphorylated by tyrosine kinase in response to several growth factors. The encoded protein can act as a homodimer or as a heterodimer with SPRED2 to regulate activation of the MAP kinase cascade. Defects in this gene are a cause of neurofibromatosis type 1-like syndrome (NFLS). [provided by RefSeq, Jul 2008]

Uniprot Description

SPRED1: Tyrosine kinase substrate that inhibits growth-factor- mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow. Defects in SPRED1 are the cause of neurofibromatosis type 1-like syndrome (NFLS). It is a disorder characterized mainly by cafe au lait macules without neurofibromas or other tumor manifestations of neurofibromatosis type 1, axillary freckling, and macrocephaly. Additional clinical manifestations include Noonan-like facial dysmorphism, lipomas, learning disabilities and attention deficit-hyperactivity.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 15q14

Cellular Component: nucleoplasm; cytoplasm; caveola

Molecular Function: protein serine/threonine kinase inhibitor activity; protein binding; stem cell factor receptor binding; protein kinase binding; phosphatase binding

Biological Process: multicellular organismal development; positive regulation of DNA damage response, signal transduction by p53 class mediator; inactivation of MAPK activity

Disease: Legius Syndrome