Putative meiotic phospholipase SPO1 (SPO1) Recombinant Protein | SPO1 recombinant protein
Recombinant Saccharomyces cerevisiae Putative meiotic phospholipase SPO1 (SPO1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative meiotic phospholipase SPO1 (SPO1); Recombinant Saccharomyces cerevisiae Putative meiotic phospholipase SPO1 (SPO1); Recombinant Putative meiotic phospholipase SPO1 (SPO1); Putative meiotic phospholipase SPO1 EC= 3.1.1.-; Sporulation-specific protein 1; SPO1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-631
Sequence
TAPFQVQCPSSPLIREAKHELCPEETLYLKKKKIKTKNKLIQFLKSLTEAKFSSKFYKRVLKDPPKIGIAISGGGYRSMLVGTGFISQMNDYGLFEYSDYIAGLSGGSWILMDLVVQNFEVKSLLQEWDLEEDLLLGIPEFDISEEEIVTNAKKEYNDNDLKMKKRQGGSLITSSSNFYEQIEEIMNSIEEIPEDYMITKRNLNPLARLKKIFFPNNTFTGTDAKIETFKKVLDFYKSLHLKIKPKKMEGFQISFTDYWGKAIVQRLKKNFDDDPNHSFSFSKLVNSSKKFKECSVPIPIFVANCKNGLLSNVIFEFTPFEFGSWENILRLFVKLPYLGSKIVSGKAEKCINNFDDLGFITATSSSIFNNVLIFIWNLASQSSREAMKALNMVMGIFGLGKEEIFSISKDSSRLETDYAVYQPNPFYLYPEKDNVLTNKNHLYLVDGGEDGENIPLRTLVIPERELDVIFVLDSSSDIDNYPNGSKLKRIFEKLDEENVHYQFPNNVKTFTHPIVIGCNATKRTGHDSFLPIIIYHANANHGNASNTSTFKITYNQSEVSSMLPTGRGVFSNDYDLYYKNCLGCILTKRTMDRLPRKKKFSPFCLQCFKDYCYS
Sequence Length
631
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
72,187 Da
NCBI Official Full Name
Spo1p
NCBI Official Symbol
SPO1
NCBI Protein Information
Spo1p
UniProt Protein Name
Putative meiotic phospholipase SPO1
Protein Family
UniProt Gene Name
SPO1
UniProt Entry Name
SPO1_YEAST
Uniprot Description
Function: Regulates spindle pole duplication in meiosis I, but not in mitosis. Required for meiosis I, meiosis II chromosome segregation and spore formation. Binds phosphatidylinositol (4)P mono- and polyphosphates. Ref.4 Ref.6
Subunit structure: Interacts with SPO23. Ref.6
Subcellular location: Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein Ref.4 Ref.6.
Induction: Induced early in sporulation. Not detected during vegetative growth. Ref.4
Post-translational modification: Glycosylated. Ref.6
Sequence similarities: Belongs to the lysophospholipase family.Contains 1 PLA2c domain.
Sequence caution: The sequence AAB38425.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAA95872.1 differs from that shown. Reason: Erroneous gene model prediction.
Research Articles on SPO1
Similar Products
Product Notes
The SPO1 spo1 (Catalog #AAA1169220) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-631. The amino acid sequence is listed below: TAPFQVQCPS SPLIREAKHE LCPEETLYLK KKKIKTKNKL IQFLKSLTEA KFSSKFYKRV LKDPPKIGIA ISGGGYRSML VGTGFISQMN DYGLFEYSDY IAGLSGGSWI LMDLVVQNFE VKSLLQEWDL EEDLLLGIPE FDISEEEIVT NAKKEYNDND LKMKKRQGGS LITSSSNFYE QIEEIMNSIE EIPEDYMITK RNLNPLARLK KIFFPNNTFT GTDAKIETFK KVLDFYKSLH LKIKPKKMEG FQISFTDYWG KAIVQRLKKN FDDDPNHSFS FSKLVNSSKK FKECSVPIPI FVANCKNGLL SNVIFEFTPF EFGSWENILR LFVKLPYLGS KIVSGKAEKC INNFDDLGFI TATSSSIFNN VLIFIWNLAS QSSREAMKAL NMVMGIFGLG KEEIFSISKD SSRLETDYAV YQPNPFYLYP EKDNVLTNKN HLYLVDGGED GENIPLRTLV IPERELDVIF VLDSSSDIDN YPNGSKLKRI FEKLDEENVH YQFPNNVKTF THPIVIGCNA TKRTGHDSFL PIIIYHANAN HGNASNTSTF KITYNQSEVS SMLPTGRGVF SNDYDLYYKN CLGCILTKRT MDRLPRKKKF SPFCLQCFKD YCYS. It is sometimes possible for the material contained within the vial of "Putative meiotic phospholipase SPO1 (SPO1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
