Biosynthetic arginine decarboxylase (speA) Recombinant Protein | Swoo_2057 recombinant protein
Recombinant Shewanella woodyi Biosynthetic arginine decarboxylase (speA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Biosynthetic arginine decarboxylase (speA); Recombinant Shewanella woodyi Biosynthetic arginine decarboxylase (speA); Recombinant Biosynthetic arginine decarboxylase (speA); Biosynthetic arginine decarboxylase; ADC EC= 4.1.1.19; Swoo_2057 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-637
Sequence
MSNWSINDARTGYNVNYWSQGLYGISDEGEATVSPDPTRPECSIGLNELAKDMVKSGVNLPVLVRFPQILHHRVNSLCQAFNQAIQKYQYQADYLLVYPIKVNQQQTVVEEILASQVEKEVPQLGLEAGSKPELMAVLAMAQKASSVIICNGYKDIEYIRLALIGEKLGHKVYIVLEKLSELKTVLEESKKLGVTPRLGLRVRLAFQGKGKWQASGGEKSKFGLSASQVLTVIESLKSEEMLDSLQLLHFHLGSQIANIRDIRQGVSEAGRFYCELQKLGANVKCFDVGGGLAVDYDGTRSQSSSSMNYGLTEYANNIVSVLTDICNEYEQPMPRIISESGCYLTAHHAVLITDVIGTEAYKPEDIQPPAEDAPQLLHNMWHSWNEISGRADQRALIEIYHDCQSDLTEVHSLFALGQLSLTDRAWAEQVNLRVCHELQGVMSSKYRFHRPIIDELTEKLADKFFVNFSLFQSLPDAWGIDQVFPIMPLSGLDKAPERRAVMLDITCDSDGTIDQYVDGQGIETTLPVPAWSAESPYLIGFFLVGAYQEILGDMHNLFGDTNSAVIRLDDDGRTNIESVLAGDTVADVLRYVNLDAVSFMRTYEELVNKHIQEDERANILEELQLGLKGYTYLEDFS
Sequence Length
637
Species
Shewanella woodyi (strain ATCC 51908 / MS32)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
71,154 Da
NCBI Official Full Name
arginine decarboxylase
NCBI Official Symbol
Swoo_2057
NCBI Protein Information
arginine decarboxylase
UniProt Protein Name
Biosynthetic arginine decarboxylase
UniProt Gene Name
speA
UniProt Synonym Gene Names
ADC
UniProt Entry Name
SPEA_SHEWM
Uniprot Description
Function: Catalyzes the biosynthesis of agmatine from arginine
By similarity. HAMAP-Rule MF_01417
Catalytic activity: L-arginine = agmatine + CO2. HAMAP-Rule MF_01417
Cofactor: Magnesium
By similarity. HAMAP-Rule MF_01417Pyridoxal phosphate
By similarity. HAMAP-Rule MF_01417
Pathway: Amine and polyamine biosynthesis; agmatine biosynthesis; agmatine from L-arginine: step 1/1. HAMAP-Rule MF_01417
Sequence similarities: Belongs to the Orn/Lys/Arg decarboxylase class-II family. SpeA subfamily.
Similar Products
Product Notes
The Swoo_2057 spea (Catalog #AAA1013656) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-637. The amino acid sequence is listed below: MSNWSINDAR TGYNVNYWSQ GLYGISDEGE ATVSPDPTRP ECSIGLNELA KDMVKSGVNL PVLVRFPQIL HHRVNSLCQA FNQAIQKYQY QADYLLVYPI KVNQQQTVVE EILASQVEKE VPQLGLEAGS KPELMAVLAM AQKASSVIIC NGYKDIEYIR LALIGEKLGH KVYIVLEKLS ELKTVLEESK KLGVTPRLGL RVRLAFQGKG KWQASGGEKS KFGLSASQVL TVIESLKSEE MLDSLQLLHF HLGSQIANIR DIRQGVSEAG RFYCELQKLG ANVKCFDVGG GLAVDYDGTR SQSSSSMNYG LTEYANNIVS VLTDICNEYE QPMPRIISES GCYLTAHHAV LITDVIGTEA YKPEDIQPPA EDAPQLLHNM WHSWNEISGR ADQRALIEIY HDCQSDLTEV HSLFALGQLS LTDRAWAEQV NLRVCHELQG VMSSKYRFHR PIIDELTEKL ADKFFVNFSL FQSLPDAWGI DQVFPIMPLS GLDKAPERRA VMLDITCDSD GTIDQYVDGQ GIETTLPVPA WSAESPYLIG FFLVGAYQEI LGDMHNLFGD TNSAVIRLDD DGRTNIESVL AGDTVADVLR YVNLDAVSFM RTYEELVNKH IQEDERANIL EELQLGLKGY TYLEDFS. It is sometimes possible for the material contained within the vial of "Biosynthetic arginine decarboxylase (speA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
