Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Speedy protein A (SPDYA) Recombinant Protein | SPDYA recombinant protein

Recombinant Human Speedy protein A (SPDYA)

Gene Names
SPDYA; SPY1; SPDY1; RINGO3; RINGOA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Speedy protein A (SPDYA); Recombinant Human Speedy protein A (SPDYA); SPDYA recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-313, Full length protein
Sequence
MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPKGPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTRINFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLKKDKSMEWFTGSEE
Sequence Length
313
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,269 Da
NCBI Official Full Name
speedy protein A isoform 2
NCBI Official Synonym Full Names
speedy/RINGO cell cycle regulator family member A
NCBI Official Symbol
SPDYA
NCBI Official Synonym Symbols
SPY1; SPDY1; RINGO3; RINGOA
NCBI Protein Information
speedy protein A
UniProt Protein Name
Speedy protein A
Protein Family
UniProt Gene Name
SPDYA
UniProt Synonym Gene Names
RINGO A; hSpy/Ringo A; Spy1

Uniprot Description

Regulates the G1/S phase transition of the cell cycle by binding and activating CDK1 and CDK2 (PubMed:12972555). Contributes to CDK2 activation without promoting CDK2 phosphorylation, by inducing a conformation change of the CDK2 T-loop that obstructs the substrate-binding cleft prior to kinase activation (PubMed:28666995). Mediates cell survival during the DNA damage process through activation of CDK2 (PubMed:12839962).

Research Articles on SPDYA

Similar Products

Product Notes

The SPDYA spdya (Catalog #AAA1297394) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-313, Full length protein. The amino acid sequence is listed below: MRHNQMCCET PPTVTVYVKS GSNRSHQPKK PITLKRPICK DNWQAFEKNT HNNNKSKRPK GPCLVIQRQD MTAFFKLFDD DLIQDFLWMD CCCKIADKYL LAMTFVYFKR AKFTISEHTR INFFIALYLA NTVEEDEEET KYEIFPWALG KNWRKLFPNF LKLRDQLWDR IDYRAIVSRR CCEEVMAIAP THYIWQRERS VHHSGAVRNY NRDEVQLPRG PSATPVDCSL CGKKRRYVRL GLSSSSSLSS HTAGVTEKHS QDSYNSLSMD IIGDPSQAYT GSEVVNDHQS NKGKKTNFLK KDKSMEWFTG SEE. It is sometimes possible for the material contained within the vial of "Speedy protein A (SPDYA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.