Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SAM pointed domain-containing Ets transcription factor (SPDEF) Recombinant Protein | SPDEF recombinant protein

Recombinant Human SAM pointed domain-containing Ets transcription factor (SPDEF)

Gene Names
SPDEF; PDEF; bA375E1.3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
SAM pointed domain-containing Ets transcription factor (SPDEF); Recombinant Human SAM pointed domain-containing Ets transcription factor (SPDEF); SPDEF recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-335, Full length protein
Sequence
MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI
Sequence Length
335
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,715 Da
NCBI Official Full Name
SAM pointed domain-containing Ets transcription factor isoform 2
NCBI Official Synonym Full Names
SAM pointed domain containing ETS transcription factor
NCBI Official Symbol
SPDEF
NCBI Official Synonym Symbols
PDEF; bA375E1.3
NCBI Protein Information
SAM pointed domain-containing Ets transcription factor
UniProt Protein Name
SAM pointed domain-containing Ets transcription factor
UniProt Gene Name
SPDEF
UniProt Synonym Gene Names
PDEF; PSE; Prostate-specific Ets

NCBI Description

The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

May function as an androgen-independent transactivator of the prostate-specific antigen (PSA) promoter. Binds to 5'-GGAT-3' DNA sequences. May play a role in the regulation of the prostate gland and/or prostate cancer development. Acts as a transcriptional activator for SERPINB5 promoter.

Research Articles on SPDEF

Similar Products

Product Notes

The SPDEF spdef (Catalog #AAA1226540) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-335, Full length protein. The amino acid sequence is listed below: MGSASPGLSS VSPSHLLLPP DTVSRTGLEK AAAGAVGLER RDWSPSPPAT PEQGLSAFYL SYFDMLYPED SSWAAKAPGA SSREEPPEEP EQCPVIDSQA PAGSLDLVPG GLTLEEHSLE QVQSMVVGEV LKDIETACKL LNITADPMDW SPSNVQKWLL WTEHQYRLPP MGKAFQELAG KELCAMSEEQ FRQRSPLGGD VLHAHLDIWK SAAWMKERTS PGAIHYCAST SEESWTDSEV DSSCSGQPIH LWQFLKELLL KPHSYGRFIR WLNKEKGIFK IEDSAQVARL WGIRKNRPAM NYDKLSRSIR QYYKKGIIRK PDISQRLVYQ FVHPI. It is sometimes possible for the material contained within the vial of "SAM pointed domain-containing Ets transcription factor (SPDEF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.