SPARC recombinant protein

Recombinant Human SPARC protein

Cat. Num. AAA967794

• Gene Names: SPARC; ON; BM-40
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: SPARC; Recombinant Human SPARC protein; Basement-membrane protein 40; BM-40; Osteonectin; ON; Secreted protein acidic and rich in cysteine; SPARC recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 18-303aa; Full Length
• Sequence: APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
• Sequence Length: 302

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SPARC recombinant protein

Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca2+ with a low affinity and an EF-hand loop that binds a Ca2+ ion with a high affinity.

Product Categories/Family for SPARC recombinant protein

Cardiovascular

References

Cloning and complete amino acid sequences of human and murine basement membrane protein BM-40 (SPARC, osteonectin)

NCBI and Uniprot Product Information

• NCBI GI #: 827342585
• NCBI GeneID: 6678
• NCBI Accession #: NP_001296372.1
• NCBI GenBank Nucleotide #: NM_001309443.1
• UniProt Accession #: P09486; Q6IBK4; D3DQH9
• Molecular Weight: 59.7 kDa
• NCBI Official Full Name: SPARC isoform 2
• NCBI Official Synonym Full Names: secreted protein acidic and cysteine rich
• NCBI Official Symbol: SPARC
• NCBI Official Synonym Symbols: ON; BM-40
• NCBI Protein Information: SPARC
• UniProt Protein Name: SPARC
• Protein Family: SPARC
• UniProt Gene Name: SPARC
• UniProt Synonym Gene Names: ON; BM-40; ON
• UniProt Entry Name: SPRC_HUMAN

NCBI Description

This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2015]

Uniprot Description

SPARC: Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. Belongs to the SPARC family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5q31.3-q32

Cellular Component: basement membrane; cell surface; cytoplasm; extracellular region; extracellular space; mitochondrion; nuclear matrix; plasma membrane; platelet alpha granule membrane

Molecular Function: calcium ion binding; collagen binding; extracellular matrix binding; protein binding

Biological Process: blood coagulation; extracellular matrix organization and biogenesis; heart development; inner ear development; lung development; negative regulation of angiogenesis; negative regulation of endothelial cell proliferation; ossification; platelet activation; platelet degranulation; receptor-mediated endocytosis; regulation of cell morphogenesis; response to cadmium ion; response to calcium ion; response to cAMP; response to cytokine stimulus; response to ethanol; response to glucocorticoid stimulus; response to gravity; response to L-ascorbic acid; response to lead ion; response to lipopolysaccharide; response to peptide hormone stimulus; signal transduction

Disease: Osteogenesis Imperfecta, Type Xvii