Hyaluronidase PH-20 (SPAM1) Recombinant Protein | SPAM1 recombinant protein
Recombinant Guinea pig Hyaluronidase PH-20 (SPAM1)
Gene Names
Spam1; PH20; PH-20
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hyaluronidase PH-20 (SPAM1); Recombinant Guinea pig Hyaluronidase PH-20 (SPAM1); SPAM1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
36-492, Full length protein
Sequence
DKRAPPLIPNVPLLWVWNAPTEFCIGGTNQPLDMSFFSIVGTPRKNITGQSITLYYVDRLGYYPYIDPHTGAIVHGGLPQLMNLQQHLRKSRQDILFYMPTDSVGLAVIDWEEWRPTWTRNWRPKDIYRNKSIELVKSQHPQYNHSYAVAVAKRDFERTGKAFMLETLKLGKSLRPSSLWGYYLFPDCYNTHFTKPNYDGHCPPIELQRNNDLQWLWNDSTALYPSVYLTSRVRSSQNGALYVRNRVHESIRVSKLMDDKNPLPIYVYIRLVFTDQTTTFLELDDLVHSVGEIVPLGVSGIIIWGSLSLTRSLVSCIGLENYMKGTLLPYLINVTLAAKMCGQVLCKNQGICTRKDWNTNTYLHLNATNFDIELQQNGKFVVHGKPSLEDLQEFSKNFHCSCYTNVACKDRLDVHNVRSVNVCTANNICIDAVLNFPSLDDDDEPPITDDTSQNQDS
Sequence Length
457
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SPAM1 recombinant protein
Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1. This gene encodes a GPI-anchored enzyme located on the human sperm surface and inner acrosomal membrane. This multifunctional protein is a hyaluronidase that enables sperm to penetrate through the hyaluronic acid-rich cumulus cell layer surrounding the oocyte, a receptor that plays a role in hyaluronic acid induced cell signaling, and a receptor that is involved in sperm-zona pellucida adhesion. Abnormal expression of this gene in tumors has implicated this protein in degradation of basement membranes leading to tumor invasion and metastasis. Multiple protein isoforms are encoded by transcript variants of this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,365 Da
NCBI Official Full Name
hyaluronidase PH-20
NCBI Official Symbol
Spam1
NCBI Official Synonym Symbols
PH20; PH-20
NCBI Protein Information
hyaluronidase PH-20
UniProt Protein Name
Hyaluronidase PH-20
Protein Family
UniProt Gene Name
SPAM1
UniProt Synonym Gene Names
PH-20; PH20; Hyal-PH20
Uniprot Description
Involved in sperm-egg adhesion. Upon fertilization sperm must first penetrate a layer of cumulus cells that surrounds the egg before reaching the zona pellucida. The cumulus cells are embedded in a matrix containing hyaluronic acid which is formed prior to ovulation. This protein aids in penetrating the layer of cumulus cells by digesting hyaluronic acid.
Similar Products
Product Notes
The SPAM1 spam1 (Catalog #AAA962285) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 36-492, Full length protein. The amino acid sequence is listed below: DKRAPPLIPN VPLLWVWNAP TEFCIGGTNQ PLDMSFFSIV GTPRKNITGQ SITLYYVDRL GYYPYIDPHT GAIVHGGLPQ LMNLQQHLRK SRQDILFYMP TDSVGLAVID WEEWRPTWTR NWRPKDIYRN KSIELVKSQH PQYNHSYAVA VAKRDFERTG KAFMLETLKL GKSLRPSSLW GYYLFPDCYN THFTKPNYDG HCPPIELQRN NDLQWLWNDS TALYPSVYLT SRVRSSQNGA LYVRNRVHES IRVSKLMDDK NPLPIYVYIR LVFTDQTTTF LELDDLVHSV GEIVPLGVSG IIIWGSLSLT RSLVSCIGLE NYMKGTLLPY LINVTLAAKM CGQVLCKNQG ICTRKDWNTN TYLHLNATNF DIELQQNGKF VVHGKPSLED LQEFSKNFHC SCYTNVACKD RLDVHNVRSV NVCTANNICI DAVLNFPSLD DDDEPPITDD TSQNQDS. It is sometimes possible for the material contained within the vial of "Hyaluronidase PH-20 (SPAM1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
