Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sperm-associated antigen 4 protein (SPAG4) Recombinant Protein | SPAG4 recombinant protein

Recombinant Human Sperm-associated antigen 4 protein (SPAG4)

Gene Names
SPAG4; SUN4; CT127
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sperm-associated antigen 4 protein (SPAG4); Recombinant Human Sperm-associated antigen 4 protein (SPAG4); SPAG4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-437aa; full length protein
Sequence
MRRSSRPGSASSSRKHTPNFFSENSSMSITSEDSKGLRSAEPGPGEPEGRRARGPSCGEP ALSAGVPGGTTWAGSSQQKPAPRSHNWQTACGAATVRGGASEPTGSPVVSEEPLDLLPTL DLRQEMPPPRVFKSFLSLLFQGLSVLLSLAGDVLVSMYREVCSIRFLFTAVSLLSLFLSA FWLGLLYLVSPLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSER VAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYADRNTAYFWNRFSFWNYARPPTV ILEPHVFPGNCWAFEGDQGQVVIQLPGRVQLSDITLQHPPPSVEHTGGANSAPRDFAVFG LQVYDETEVSLGKFTFDVEKSEIQTFHLQNDPPAAFPKVKIQILSNWGHPRFTCLYRVRA HGVRTSEGAEGSAQGPH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SPAG4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,165 Da
NCBI Official Full Name
sperm-associated antigen 4 protein isoform 1
NCBI Official Synonym Full Names
sperm associated antigen 4
NCBI Official Symbol
SPAG4
NCBI Official Synonym Symbols
SUN4; CT127
NCBI Protein Information
sperm-associated antigen 4 protein
UniProt Protein Name
Sperm-associated antigen 4 protein
UniProt Gene Name
SPAG4
UniProt Synonym Gene Names
SUN4
UniProt Entry Name
SPAG4_HUMAN

NCBI Description

The mammalian sperm flagellum contains two cytoskeletal structures associated with the axoneme: the outer dense fibers surrounding the axoneme in the midpiece and principal piece and the fibrous sheath surrounding the outer dense fibers in the principal piece of the tail. Defects in these structures are associated with abnormal tail morphology, reduced sperm motility, and infertility. In the rat, the protein encoded by this gene associates with an outer dense fiber protein via a leucine zipper motif and localizes to the microtubules of the manchette and axoneme during sperm tail development. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]

Uniprot Description

SPAG4: May assist the organization and assembly of outer dense fibers (ODFs), a specific structure of the sperm tail.

Protein type: Membrane protein, multi-pass; Cancer Testis Antigen (CTA); Microtubule-binding; Membrane protein, integral

Chromosomal Location of Human Ortholog: 20q11.21

Cellular Component: cytoplasm; cytoskeleton; integral to membrane; nuclear envelope

Molecular Function: protein binding; structural molecule activity

Biological Process: nuclear membrane organization and biogenesis; spermatogenesis

Research Articles on SPAG4

Similar Products

Product Notes

The SPAG4 spag4 (Catalog #AAA7030212) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-437aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SPAG4 spag4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRRSSRPGSA SSSRKHTPNF FSENSSMSIT SEDSKGLRSA EPGPGEPEGR RARGPSCGEP ALSAGVPGGT TWAGSSQQKP APRSHNWQTA CGAATVRGGA SEPTGSPVVS EEPLDLLPTL DLRQEMPPPR VFKSFLSLLF QGLSVLLSLA GDVLVSMYRE VCSIRFLFTA VSLLSLFLSA FWLGLLYLVS PLENEPKEML TLSEYHERVR SQGQQLQQLQ AELDKLHKEV STVRAANSER VAKLVFQRLN EDFVRKPDYA LSSVGASIDL QKTSHDYADR NTAYFWNRFS FWNYARPPTV ILEPHVFPGN CWAFEGDQGQ VVIQLPGRVQ LSDITLQHPP PSVEHTGGAN SAPRDFAVFG LQVYDETEVS LGKFTFDVEK SEIQTFHLQN DPPAAFPKVK IQILSNWGHP RFTCLYRVRA HGVRTSEGAE GSAQGPH. It is sometimes possible for the material contained within the vial of "Sperm-associated antigen 4 protein (SPAG4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.