Suppressor of cytokine signaling 3 (SOCS3) Recombinant Protein | SOCS3 recombinant protein
Recombinant Dog Suppressor of cytokine signaling 3 (SOCS3)
Gene Names
SOCS3; SOCS-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Suppressor of cytokine signaling 3 (SOCS3); Recombinant Dog Suppressor of cytokine signaling 3 (SOCS3); SOCS3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-225, Full length protein
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVCKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPAPPTEPSSEVSEQPPSQPLPGNPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGAIREFLDQYDAPL
Sequence Length
225
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SOCS3 recombinant protein
This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. This protein can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,718 Da
NCBI Official Full Name
suppressor of cytokine signaling 3
NCBI Official Synonym Full Names
suppressor of cytokine signaling 3
NCBI Official Symbol
SOCS3
NCBI Official Synonym Symbols
SOCS-3
NCBI Protein Information
suppressor of cytokine signaling 3
UniProt Protein Name
Suppressor of cytokine signaling 3
Protein Family
UniProt Gene Name
SOCS3
UniProt Synonym Gene Names
SOCS-3
Uniprot Description
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin and leptin receptors. Inhibits JAK2 kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize IL6ST ().
Similar Products
Product Notes
The SOCS3 socs3 (Catalog #AAA1358804) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-225, Full length protein. The amino acid sequence is listed below: MVTHSKFPAA GMSRPLDTSL RLKTFSSKSE YQLVVNAVCK LQESGFYWSA VTGGEANLLL SAEPAGTFLI RDSSDQRHFF TLSVKTQSGT KNLRIQCEGG SFSLQSDPRS TQPVPRFDCV LKLVHHYMPP PGAPSFPAPP TEPSSEVSEQ PPSQPLPGNP PRRAYYIYSG GEKIPLVLSR PLSSNVATLQ HLCRKTVNGH LDSYEKVTQL PGAIREFLDQ YDAPL. It is sometimes possible for the material contained within the vial of "Suppressor of cytokine signaling 3 (SOCS3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
