Sterol O-acyltransferase 1 (SOAT1) Recombinant Protein | SOAT1 recombinant protein
Recombinant Macaca fascicularis Sterol O-acyltransferase 1 (SOAT1)
Gene Names
SOAT1; ACAT; ACAT1; ACAT-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sterol O-acyltransferase 1 (SOAT1); Recombinant Macaca fascicularis Sterol O-acyltransferase 1 (SOAT1); SOAT1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-550aa; full length protein
Sequence
MVGEEKMSLRNRLSKSRENPEEDEDQRKPAKESLEAPSNGRIDIKQLIAKKIKLTAEAEE LKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILEGEKNNHRAKDLRAPPEQGK IFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGK FPTVVWTWWIMFLSTFSVPYFLFQRWATGYSKSSHPLINSLFHGFLFMVFQIGILGFGPT YVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF LFAPTLIYRDSYPRNPTVRWGYVAMQFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSAR VLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTW NVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAAFAVSAVVHEYALAVCLSFFYPVLFVLFM FFGMAFNFIVNDSRKKPIWNVMMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVR PRSWTCRYVF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SOAT1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
64,700 Da
NCBI Official Full Name
Sterol O-acyltransferase 1
NCBI Official Symbol
SOAT1
NCBI Official Synonym Symbols
ACAT; ACAT1; ACAT-1
NCBI Protein Information
sterol O-acyltransferase 1
UniProt Protein Name
Sterol O-acyltransferase 1
Protein Family
UniProt Gene Name
SOAT1
UniProt Synonym Gene Names
ACAT; ACAT1; ACAT-1
UniProt Entry Name
SOAT1_MACFA
Uniprot Description
Plays a role in lipoprotein assembly and dietary cholesterol absorption. In addition to its acyltransferase activity, it may act as a ligase.
Similar Products
Product Notes
The SOAT1 soat1 (Catalog #AAA7030196) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-550aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SOAT1 soat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVGEEKMSLR NRLSKSRENP EEDEDQRKPA KESLEAPSNG RIDIKQLIAK KIKLTAEAEE LKPFFMKEVG SHFDDFVTNL IEKSASLDNG GCALTTFSIL EGEKNNHRAK DLRAPPEQGK IFIARRSLLD ELLEVDHIRT IYHMFIALLI LFILSTLVVD YIDEGRLVLE FSLLSYAFGK FPTVVWTWWI MFLSTFSVPY FLFQRWATGY SKSSHPLINS LFHGFLFMVF QIGILGFGPT YVVLAYTLPP ASRFIIIFEQ IRFVMKAHSF VRENVPRVLN SAKEKSSTVP IPTVNQYLYF LFAPTLIYRD SYPRNPTVRW GYVAMQFAQV FGCFFYVYYI FERLCAPLFR NIKQEPFSAR VLVLCVFNSI LPGVLILFLT FFAFLHCWLN AFAEMLRFGD RMFYKDWWNS TSYSNYYRTW NVVVHDWLYY YAYKDFLWFF SKRFKSAAML AAFAVSAVVH EYALAVCLSF FYPVLFVLFM FFGMAFNFIV NDSRKKPIWN VMMWTSLFLG NGVLLCFYSQ EWYARQHCPL KNPTFLDYVR PRSWTCRYVF. It is sometimes possible for the material contained within the vial of "Sterol O-acyltransferase 1 (SOAT1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
