U1 small nuclear ribonucleoprotein C (SNRPC) Recombinant Protein | SNRPC recombinant protein

Recombinant Human U1 small nuclear ribonucleoprotein C (SNRPC)

Cat. Num. AAA952824

• Gene Names: SNRPC; U1C; Yhc1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: U1 small nuclear ribonucleoprotein C (SNRPC); Recombinant Human U1 small nuclear ribonucleoprotein C (SNRPC); SNRPC recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-159, Full length protein
• Sequence: MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
• Sequence Length: 159

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 4507127
• NCBI GeneID: 6631
• NCBI Accession #: NP_003084.1
• NCBI GenBank Nucleotide #: NM_003093.2
• UniProt Accession #: P09234; Q5TAL3
• Molecular Weight: 17,394 Da
• NCBI Official Full Name: U1 small nuclear ribonucleoprotein C
• NCBI Official Synonym Full Names: small nuclear ribonucleoprotein polypeptide C
• NCBI Official Symbol: SNRPC
• NCBI Official Synonym Symbols: U1C; Yhc1
• NCBI Protein Information: U1 small nuclear ribonucleoprotein C
• UniProt Protein Name: U1 small nuclear ribonucleoprotein C
• UniProt Gene Name: SNRPC
• UniProt Synonym Gene Names: U1 snRNP C; U1-C; U1C

NCBI Description

This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant.[provided by RefSeq, Oct 2009]

Uniprot Description

Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. SNRPC/U1-C is directly involved in initial 5' splice-site recognition for both constitutive and regulated alternative splicing. The interaction with the 5' splice-site seems to precede base-pairing between the pre-mRNA and the U1 snRNA. Stimulates commitment or early (E) complex formation by stabilizing the base pairing of the 5' end of the U1 snRNA and the 5' splice-site region.