U11/U12 small nuclear ribonucleoprotein 35 kDa protein (SNRNP35) Recombinant Protein | SNRNP35 recombinant protein
Recombinant Human U11/U12 small nuclear ribonucleoprotein 35 kDa protein (SNRNP35)
Gene Names
SNRNP35; HM-1; U1SNRNPBP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
U11/U12 small nuclear ribonucleoprotein 35 kDa protein (SNRNP35); Recombinant Human U11/U12 small nuclear ribonucleoprotein 35 kDa protein (SNRNP35); SNRNP35 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-246, Full length protein
Sequence
MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRVWPDNDWERERDFRDDRIKGREKKERGK
Sequence Length
246
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,992 Da
NCBI Official Full Name
U11/U12 small nuclear ribonucleoprotein 35 kDa protein isoform a
NCBI Official Synonym Full Names
small nuclear ribonucleoprotein U11/U12 subunit 35
NCBI Official Symbol
SNRNP35
NCBI Official Synonym Symbols
HM-1; U1SNRNPBP
NCBI Protein Information
U11/U12 small nuclear ribonucleoprotein 35 kDa protein
UniProt Protein Name
U11/U12 small nuclear ribonucleoprotein 35 kDa protein
Protein Family
UniProt Gene Name
SNRNP35
UniProt Synonym Gene Names
HM1; U1SNRNPBP; U11/U12 snRNP 35 kDa protein; U11/U12-35K
NCBI Description
The protein encoded by this gene is a homolog of the U1-snRNP binding protein. The N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, which is a characteristic of a variety of splicing factors. This protein is a component of the U11/U12 small nuclear ribonucleoproteins (snRNP) that form part of the U12-type spliceosome. Alternative splicing results in multiple transcript variants encoding two distinct isoforms and representing a non-protein coding variant. [provided by RefSeq, Aug 2013]
Research Articles on SNRNP35
Similar Products
Product Notes
The SNRNP35 snrnp35 (Catalog #AAA1469302) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-246, Full length protein. The amino acid sequence is listed below: MNDWMPIAKE YDPLKAGSID GTDEDPHDRA VWRAMLARYV PNKGVIGDPL LTLFVARLNL QTKEDKLKEV FSRYGDIRRL RLVRDLVTGF SKGYAFIEYK EERAVIKAYR DADGLVIDQH EIFVDYELER TLKGWIPRRL GGGLGGKKES GQLRFGGRDR PFRKPINLPV VKNDLYREGK RERRERSRSR ERHWDSRTRD RDHDRGREKR WQEREPTRVW PDNDWERERD FRDDRIKGRE KKERGK. It is sometimes possible for the material contained within the vial of "U11/U12 small nuclear ribonucleoprotein 35 kDa protein (SNRNP35), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
