Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

SNCA/Alpha-synuclein Recombinant Protein | SNCA recombinant protein

Recombinant Human SNCA/Alpha-synuclein Protein

Gene Names
SNCA; PD1; NACP; PARK1; PARK4
Purity
>95% by SDS-PAGE.
Synonyms
SNCA/Alpha-synuclein; Recombinant Human SNCA/Alpha-synuclein Protein; Alpha-Synuclein; Non-A Beta Component of AD Amyloid; Non-A4 Component of AmyloidPrecursor; NACP; SNCA; PARK1; SNCA recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Sequence Length
140
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human SNCA/Alpha-synuclein Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

Related Product Information for SNCA recombinant protein
Description: Recombinant Human SNCA/Alpha-synuclein Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ala140) of human SNCA/Alpha-synuclein (Accession #P37840).

Background: Alpha-Synuclein (SNCA) is a member of the Synuclein family. SNCA is expressed principally in brain but alsoexpressed in low concentrations in all tissues except liver. SNCA interacts with UCHL1, Phospholipase D andhistones. SNCA can include beta- and gamma-synuclein. In addition, SNCA is an important regulatorycomponent of vesicular transport in neuronal cells. It has been suggested that SNCA is related to thepathogenesis of Parkinson's Disease and neurodegenerative disorders. Defects in SNCA will lead to DementiaLewy Body (DLB).
Product Categories/Family for SNCA recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
alpha-synuclein isoform NACP140
NCBI Official Synonym Full Names
synuclein alpha
NCBI Official Symbol
SNCA
NCBI Official Synonym Symbols
PD1; NACP; PARK1; PARK4
NCBI Protein Information
alpha-synuclein
UniProt Protein Name
Alpha-synuclein
Protein Family
UniProt Gene Name
SNCA
UniProt Synonym Gene Names
NACP; PARK1; NACP
UniProt Entry Name
SYUA_HUMAN

NCBI Description

Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016]

Uniprot Description

SNCA: a member of the synuclein family. Abundantly expressed in the brain. Inhibits phospholipase D2 selectively. May integrate presynaptic signaling and membrane trafficking. Implicated in the pathogenesis of Parkinson's disease. A major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced isoforms transcripts have been identified.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: Golgi apparatus; nuclear outer membrane; rough endoplasmic reticulum; mitochondrion; lysosome; extracellular region; fibril; terminal button; cell cortex; inclusion body; cytosol; mitochondrial respiratory chain complex I; actin cytoskeleton; synaptic vesicle; platelet alpha granule membrane; growth cone; perinuclear region of cytoplasm; axon; cytoplasm; plasma membrane; ribosome; cell junction; nucleus

Molecular Function: protein domain specific binding; identical protein binding; histone binding; zinc ion binding; kinesin binding; microtubule binding; ferrous iron binding; caspase inhibitor activity; magnesium ion binding; beta-tubulin binding; phosphoprotein binding; protein N-terminus binding; oxidoreductase activity; Hsp70 protein binding; calcium ion binding; dynein binding; protein binding; phospholipase binding; copper ion binding; phospholipid binding; fatty acid binding; tau protein binding; alpha-tubulin binding

Biological Process: regulation of acyl-CoA biosynthetic process; adult locomotory behavior; positive regulation of apoptosis; positive regulation of endocytosis; response to lipopolysaccharide; dopamine biosynthetic process; positive regulation of neurotransmitter secretion; calcium ion homeostasis; response to magnesium ion; fibril organization and biogenesis; synapse organization and biogenesis; dopamine uptake; negative regulation of neuron apoptosis; response to drug; negative regulation of dopamine metabolic process; synaptic vesicle endocytosis; negative regulation of transporter activity; negative regulation of apoptosis; regulation of long-term neuronal synaptic plasticity; negative regulation of serotonin uptake; mitochondrial membrane organization and biogenesis; negative regulation of norepinephrine uptake; microglial cell activation; negative regulation of transcription from RNA polymerase II promoter; negative regulation of caspase activity; negative regulation of monooxygenase activity; fatty acid metabolic process; regulation of dopamine secretion; negative regulation of dopamine uptake; negative regulation of histone acetylation; negative regulation of exocytosis; negative regulation of protein amino acid phosphorylation; behavioral response to cocaine; phospholipid metabolic process; receptor internalization; response to iron(II) ion; positive regulation of receptor recycling; aging; caspase activation; neutral lipid metabolic process; protein destabilization; regulation of macrophage activation; regulation of glutamate secretion; negative regulation of microtubule polymerization; positive regulation of peptidyl-serine phosphorylation; organelle ATP synthesis coupled electron transport; regulation of locomotion; positive regulation of release of sequestered calcium ion into cytosol; regulation of excitatory postsynaptic membrane potential

Disease: Parkinson Disease 4, Autosomal Dominant; Parkinson Disease 1, Autosomal Dominant; Dementia, Lewy Body

Research Articles on SNCA

Similar Products

Product Notes

The SNCA snca (Catalog #AAA9140042) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEA. It is sometimes possible for the material contained within the vial of "SNCA/Alpha-synuclein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual