Sphingomyelin phosphodiesterase 2 (Smpd2) Recombinant Protein | Smpd2 recombinant protein
Recombinant Rat Sphingomyelin phosphodiesterase 2 (Smpd2)
Gene Names
Smpd2; nSMase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sphingomyelin phosphodiesterase 2 (Smpd2); Recombinant Rat Sphingomyelin phosphodiesterase 2 (Smpd2); Smpd2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-422aa; full length protein
Sequence
MKHNFSLRLRVFNLNCWDIPYLSKHRADRMKRLGDFLNLESFDLALLEEVWSEQDFQYLK QKLSLTYPDAHYFRSGIIGSGLCVFSRHPIQEIVQHVYTLNGYPYKFYHGDWFCGKAVGL LVLHLSGLVLNAYVTHLHAEYSRQKDIYFAHRVAQAWELAQFIHHTSKKANVVLLCGDLN MHPKDLGCCLLKEWTGLRDAFVETEDFKGSEDGCTMVPKNCYVSQQDLGPFPFGVRIDYV LYKAVSGFHICCKTLKTTTGCDPHNGTPFSDHEALMATLCVKHSPPQEDPCSAHGSAERS ALISALREARTELGRGIAQARWWAALFGYVMILGLSLLVLLCVLAAGEEAREVAIMLWTP SVGLVLGAGAVYLFHKQEAKSLCRAQAEIQHVLTRTTETQDLGSEPHPTHCRQQEADRAE EK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Smpd2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47,645 Da
NCBI Official Full Name
sphingomyelin phosphodiesterase 2
NCBI Official Synonym Full Names
sphingomyelin phosphodiesterase 2
NCBI Official Symbol
Smpd2
NCBI Official Synonym Symbols
nSMase
NCBI Protein Information
sphingomyelin phosphodiesterase 2
UniProt Protein Name
Sphingomyelin phosphodiesterase 2
UniProt Gene Name
Smpd2
UniProt Synonym Gene Names
Lyso-PAF-PLC; N-SMase; nSMase
UniProt Entry Name
NSMA_RAT
NCBI Description
catalyzes the Mg2+ dependent hydrolysis of sphingomyelin to form N-acylsphingosine and choline phosphate; also has a lower activity for the hydrolysis of lyso-platelet activating factor to 1-alkylglycerol [RGD, Feb 2006]
Uniprot Description
Converts sphingomyelin to ceramide. Hydrolyze 1-acyl-2-lyso-sn-glycero-3-phosphocholine (lyso-PC) and 1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine (lyso-platelet-activating factor). The physiological substrate seems to be Lyso-PAF.
Research Articles on Smpd2
Similar Products
Product Notes
The Smpd2 smpd2 (Catalog #AAA7030183) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-422aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Smpd2 smpd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKHNFSLRLR VFNLNCWDIP YLSKHRADRM KRLGDFLNLE SFDLALLEEV WSEQDFQYLK QKLSLTYPDA HYFRSGIIGS GLCVFSRHPI QEIVQHVYTL NGYPYKFYHG DWFCGKAVGL LVLHLSGLVL NAYVTHLHAE YSRQKDIYFA HRVAQAWELA QFIHHTSKKA NVVLLCGDLN MHPKDLGCCL LKEWTGLRDA FVETEDFKGS EDGCTMVPKN CYVSQQDLGP FPFGVRIDYV LYKAVSGFHI CCKTLKTTTG CDPHNGTPFS DHEALMATLC VKHSPPQEDP CSAHGSAERS ALISALREAR TELGRGIAQA RWWAALFGYV MILGLSLLVL LCVLAAGEEA REVAIMLWTP SVGLVLGAGA VYLFHKQEAK SLCRAQAEIQ HVLTRTTETQ DLGSEPHPTH CRQQEADRAE EK. It is sometimes possible for the material contained within the vial of "Sphingomyelin phosphodiesterase 2 (Smpd2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
