Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 (Smarca5) Recombinant Protein | Smarca5 recombinant protein

Recombinant Mouse SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 (Smarca5) , partial

Gene Names
Smarca5; Snf2h; MommeD4; 4933427E24Rik; D030040M08Rik; D330027N15Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 (Smarca5); Recombinant Mouse SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 (Smarca5); partial; Smarca5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-109. Partial.
Sequence
SSAVEPPPPPPPESAPSKPSAAGAGGSSSGNKGGPEGGAAPAAPCAAGSGPADTEMEEVFDHGSPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAA
Sequence Length
109
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Smarca5 recombinant protein
This protein is a member of the SWI
SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. This protein is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
121,627 Da
NCBI Official Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
NCBI Official Synonym Full Names
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
NCBI Official Symbol
Smarca5
NCBI Official Synonym Symbols
Snf2h; MommeD4; 4933427E24Rik; D030040M08Rik; D330027N15Rik
NCBI Protein Information
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
UniProt Protein Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
UniProt Gene Name
Smarca5
UniProt Synonym Gene Names
Snf2h; mSnf2h

Uniprot Description

Helicase that possesses intrinsic ATP-dependent nucleosome-remodeling activity. Complexes containing SMARCA5 are capable of forming ordered nucleosome arrays on chromatin; this may require intact histone H4 tails. Also required for replication of pericentric heterochromatin in S-phase specifically in conjunction with BAZ1A. Probably plays a role in repression of polI dependent transcription of the rDNA locus, through the recruitment of the SIN3/HDAC1 corepressor complex to the rDNA promoter. Essential component of the WICH complex, a chromatin remodeling complex that mobilizes nucleosomes and reconfigures irregular chromatin to a regular nucleosomal array structure. The WICH complex regulates the transcription of various genes, has a role in RNA polymerase I and RNA polymerase III transcription, mediates the histone H2AX phosphorylation at 'Tyr-142', and is involved in the maintenance of chromatin structures during DNA replication processes. Essential component of the NoRC (nucleolar remodeling complex) complex, a complex that mediates silencing of a fraction of rDNA by recruiting histone-modifying enzymes and DNA methyltransferases, leading to heterochromatin formation and transcriptional silencing.

Research Articles on Smarca5

Similar Products

Product Notes

The Smarca5 smarca5 (Catalog #AAA1414181) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-109. Partial. The amino acid sequence is listed below: SSAVEPPPPP PPESAPSKPS AAGAGGSSSG NKGGPEGGAA PAAPCAAGSG PADTEMEEVF DHGSPGKQKE IQEPDPTYEE KMQTDRANRF EYLLKQTELF AHFIQPAA . It is sometimes possible for the material contained within the vial of "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 (Smarca5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.